KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA14996Help
Entry
Dpse_GA14996      CDS       T01032                                 

Definition
GA14996 gene product from transcript GA14996-RA (EC:2.1.3.2 3.5.2.-)
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dpo00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dpo00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 2238 aa AA seqDB search
MRQVDCYLVLEDGTVMPGLSFGHVAKNSPVGGEVVFQTGMVGYTEALTDRSYSGQILVLT
YPLIGNYGVPCPEEDEHGLPKHFEWLKGAVQATALVVGEVAECAWHWRSSKTLPKWLAEH
KVPGISGVDTRALTKKLREQGSLLGRIVYKAPKEGPNKLIFEDPNTRNLAKECSVRKKMV
FGDATSGKGPRIAIIDCGLKLNQLRCLLQRGASVQLLPWSADLKDEDYDALFLSNGPGNP
ESCDAIVEEVRRVIRAGTKPIFGICLGHQLLAKAIGCSTFKMKYGNRGHNLPCLHRATGR
CLMTSQNHGYAVDLQDLPGEWEELFVNANDGTNEGIVHRSKPYFSVQFHPEHHAGPCDTE
FLFDVFMESIRTPQLSVPELISRRLRPAKLLPVQPKPRKVLILGSGGLSIGQAGEFDYSG
SQAIKAMRESGIQTVLINPNIATVQTSKGMADKCYFLPLTPHYVEEVIKSERPNGVLLTF
GGQTALNCGVELDRAGVFEKYNVRILGTPIQSIIETEDRKLFAQRVNDIGEQVAPSEAVY
SVAEALEAAGRLGYPVMARAAFSLGGLGSGFANNEQELENLAEQALAHSSQLIVDKSLKG
WKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGESIVVAPSQTLSDREYQMLRNTALKVI
RHLGVVGECNIQYALCPHSEQFYIIEVNARLSRSSALASKATGYPLAYVAAKLALGLPLP
EIKNSVTGNTTACFEPSLDYCVVKIPRWDLAKFTRVSKHIGSSMKSVGEVMSIGRSFEEA
FQKALRMVDSDVLGFDADVVVVDEQKLADQLSEPTDRRPFFLAAALTMGMDIQQLHKLTK
IDQWFLHKLERIVFFNHHLSRLNASGSQLGPDLLLKAKRLGFSDKQIAKATKSTELVVRQ
QRHQLGIRPFVKQIDTVAGEWPASTNYLYTTYHGTEHDVEFPGGHIIVVGSGVYRIGSSV
EFDWCAVGCLRELRKLQKPTIMINYNPETVSTDYDMCDRLYFEEISFEVVMDIYELESSE
GIILSMGGQLPNNIAMDLHRQQAKVLGTSPDSIDCAENRFKFSRMLDRKGILQPRWKELT
NLKSAIEFCEEVGYPCLVRPSYVLSGAAMNVAYSNQDLETYLNAASEVSREHPVVISKFL
TEAKEIDVDAVAADGQILCMAVSEHVENAGVHSGDATLVTPPQDLNAETLEAIKRITCAL
ASLLDVTGPFNMQLIAKNNELKVIECNVRVSRSFPFVSKTLDHDFVATATRAIVGMDVEP
IDVLHGVGKVGVKVPQFSFSRLAGADVQLGVEMASTGEVAGFGDNRYEAYLKAMMSTGFQ
IPKNAVLLSIGSFKHKMELLPSIRDLAKMGYKLYASMGTGDFYAEHGVDVESVQWTFDKT
TPDDINGELRHLAEFLANKQFDLVINLPMSGGGVRRVSSFMTHGYRTRRLAVDYSIPLVT
DVKCTKLLVESMRLMGGQPAMKTHTDCMTSRRIVKLPGFIDVHVHLREPGATHKEDFSSG
TAAALAGGVTLVCAMPNTNPSIVDKETFAQFQELARLGARCDYALYLGASDANWAQAHEL
ASQACGLKMYLNDTYGTLRLSDMTAWQRHLSHWPKRAPIVCHAEKQSMAAVVLLAHLLDR
HVHICHVARKEEIQLIRAAKEKGIKVTCEVCPHHLFLSTKDVDRLGSGMSEVRPLLCSPE
DQEALWEHMEYIDVFATDHAPHTLEEKQSERPPPGFPGLETILPLLLQAVHEGRLTMEDI
KRKLHRNPRNIFNLPEQPHTYVEVDLDEEWTISGSELKTKAGWTPFEGTKVTGRVHRVVL
RGEVAFIDGQVLVQPGFGQNVRNKAGAQQLLSEATQELPSDRDANDTFARLLTVEGAAKV
HFVDEANNSNSFLRPISPSPRHRLDSSSNTTLRDYLQRTAMSVSGSASGSVAANQYSQPS
PNPVAHSLVGKHILAVDMFSKDHLNDIFNLAQLLKSRVTKDRPLDDLLRGKIMASVFYEV
STRTQCSFAAAMLRLGGRVISMDQLTSSVKKGESLEDSIKVMASYADVMVLRHPLPGAVA
RAALYSRKPVINAGDGVGEHPTQALLDIFTIREEIGTVNGLTITMCGDLKNGRTVHSLAR
LLTLYNVTLQYVAPETLQMPDEITKFVNERGVKQVFYNALALDALADTDVLYMTRIQRER
FDSDSEYQKCNGPFIVTPKLMTLAKKRMIVLHPLPRLDEISRDFDLDPRAAYFRQAEYGM
YIRMALLAMVVGCRSTAL
NT seq 6717 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaagtggactgttacctggtgctggaggatggcaccgtcatgccggggctgtcg
ttcggacatgtggccaagaatagtccggtgggaggcgaggttgtcttccaaacaggcatg
gtcggctacaccgaggcgctgacagatcgctcgtacagtggacagattctggtgctgacc
tacccgctgattggtaactatggagtgccctgcccggaggaggacgagcacggcctgccc
aagcactttgagtggctcaagggagccgtgcaggccaccgcccttgtggtgggcgaagtg
gccgagtgcgcctggcactggcgtagctccaagacgctgcccaagtggttggctgagcac
aaggtgcctggcatcagtggcgtggacacacgcgcccttaccaaaaagttgcgggagcag
ggcagccttctgggtcgcatcgtgtacaaggcccccaaggaggggccaaacaaactaatc
tttgaggatcccaacacccgtaatctagccaaggagtgcagcgtacggaagaagatggtc
ttcggggatgccaccagtggcaagggcccacgcatcgccatcatagactgcggcctgaag
ctcaatcagttgcgctgcctgctgcagcgtggtgcctctgtgcagctgctgccatggagc
gctgacctgaaggatgaggactacgatgccctcttcctgtccaacggacccggcaatccg
gagagctgcgacgcgattgttgaggaggtgcggcgcgtcatccgggctggcaccaagccc
atcttcggcatctgtctgggccaccagctgctggccaaggccattggctgctctaccttc
aagatgaagtacggcaaccgtggccacaacctgccctgcctgcaccgcgccactggccgc
tgcctgatgacctcacagaaccacggctacgcagtggatctgcaggatctacccggcgaa
tgggaggagctctttgtgaatgccaatgacggcaccaacgagggcattgtccaccgctcc
aagccctacttctcagtgcagtttcatccggagcatcatgcagggccctgcgacaccgaa
ttccttttcgatgtctttatggaatccatccgtactcctcagctgagtgtgccagaactt
attagtcgacgactgcgtcccgccaagctgctgcccgtccagcctaagccgcgcaaggtg
ctcatcctgggctctggtggcctctccattggccaggcgggcgaattcgattactccggc
tcacaggccatcaaggcgatgcgagagtctggcatccagacggtgctcatcaatccgaat
atcgccaccgtgcagacctcaaagggaatggcggacaaatgctatttcctgcccctgacc
ccccactacgtggaggaggtgatcaagtcggagcgccccaacggagtgctgctcaccttt
ggcggccagacggccctcaattgcggcgtggaactggaccgggccggagtctttgagaag
tacaatgtccgcattctgggcacacccatccagtcgatcatcgaaacggaggatcgtaag
cttttcgcccagcgcgtcaacgatattggggagcaggtggcgccatcggaggccgtctat
tcggtggccgaggctctggaggcggccggccgtctcggctatccggtgatggccagggcc
gccttctcgctgggcggcctgggctctggctttgccaacaacgaacaggagctggagaac
ctcgccgagcaggcgctggcccactctagccagctgattgtggacaaatcgctcaaaggc
tggaaggaggtcgagtacgaagtggtgcgcgatgccttcgacaactgcatcaccgtctgc
aacatggagaacttcgatccgcttggcatccacacgggcgagagcattgtggtggccccc
tcgcagacgctttcggaccgggagtatcaaatgctccgcaacaccgccctgaaggtcatc
cggcatctgggcgttgtgggggagtgcaacatccagtatgcgctctgcccccactcggag
cagttctacatcatcgaagtgaatgcgcggctgtcgcgcagctcggcgctggccagcaag
gccaccggctatcccctggcctatgtggccgccaagctggctttgggcctgcccctgccc
gagatcaagaactcggtgacggggaatacgacggcctgctttgagccctcactcgactac
tgtgtggtgaagataccgcgctgggatctggccaaattcacgcgcgtcagcaagcacatc
ggcagctccatgaagagcgtcggcgaggtgatgtccatcggacgaagcttcgaggaggcc
ttccagaaggccctacgcatggtcgacagcgatgtgctgggcttcgatgctgacgttgtg
gtcgtcgacgagcagaagctggcggatcagctctcagagccgacggatcgacggcccttt
ttcttggccgccgccctgaccatgggcatggatatccagcagctgcataagctcacaaaa
atcgatcagtggttcctgcacaagctggagcgaatcgtctttttcaaccaccatctcagc
cgcctcaatgcctcgggcagccagctgggtcccgatctgctgctcaaagccaagcgtctg
ggcttctccgacaagcagatagccaaggccaccaaaagcacagagctggtggtgcgccag
cagcgtcaccagctgggaatccgtccgtttgtcaaacagatcgacacggtggcaggggag
tggccagcgagcaccaattatctgtatacgacctatcacggcaccgagcatgacgtggag
ttccccgggggccacatcattgtggtggggtcgggcgtgtaccgcattggctcctcggtg
gagtttgactggtgcgccgtgggctgcctgcgggagctgcggaagctgcagaagccaacg
atcatgatcaactacaacccggagacggtctccaccgactacgacatgtgcgatcggctg
tactttgaggagatcagctttgaggtggtgatggacatctacgaactggagtcctccgag
ggcatcatcctctcgatggggggccagctgcccaataacattgccatggatctccaccgg
cagcaggccaaggttttgggcacttccccggactcgatcgactgtgccgagaatcgtttc
aagttctcgcgcatgctggaccggaagggcatcctccagccgcgctggaaggagttgacc
aacctcaagtcggccatcgagttctgcgaggaggtgggctacccttgcctggtcagaccc
tcgtatgtgctgtccggggcggccatgaatgtggcctactccaaccaggacctggagacg
tatctgaacgccgcctcggaggttagtcgcgagcatccggtggtcatatccaagtttctc
accgaggccaaggaaatcgacgttgatgccgtggccgccgacggccagatcctttgcatg
gccgtctctgagcatgtggagaatgcgggcgtccattcgggcgatgccacgctggtcacc
ccgccgcaggatctcaacgccgagacgctggaggccatcaagcggatcacatgcgccttg
gccagcctcctggacgttaccggacccttcaacatgcaactgattgccaagaacaacgaa
ctcaaggtcattgaatgcaacgtgcgcgtatcgcgctccttccccttcgtctcgaagacc
ctcgatcacgactttgtggcaaccgccaccagagccattgtcggcatggacgtggagccc
atcgatgtgctccatggggtcggcaaggtcggagtgaaggtgccacagtttagtttctcc
cgcctcgcgggcgccgatgtccagctgggcgtcgagatggcctccaccggagaggttgcc
ggcttcggcgacaaccgctacgaagcctacctcaaagccatgatgtccaccggctttcag
atacccaagaatgccgtactcctctccatcggtagcttcaagcacaaaatggaactgctt
ccttccatacgggatctggccaaaatgggctacaaactgtacgcctccatgggcaccggc
gatttctatgcagaacatggcgttgatgtggaatccgtacagtggactttcgataagaca
acgccggacgacatcaatggggagctgcgtcatttggccgagttcctggccaataaacag
ttcgatctggtcatcaatttgccaatgagtggcggaggtgtcagaagggtgtcctccttc
atgacgcatggctatcgcacccgtcgtctggccgtggactactccataccattggtgacg
gatgtcaagtgcaccaaactgctggtggaatcgatgcgcctgatgggtggccagccggcg
atgaagacccacacggactgcatgacctcgcggcggattgtcaagctgccgggcttcatc
gatgtccatgtgcatctgcgagagccgggtgccacgcacaaagaggacttttccagcggc
acagccgctgccttggctggcggggtcaccctggtctgtgccatgcccaacaccaatccc
tcgatcgtcgacaaggagacgtttgcccagttccaggagctggcccgcctcggtgcgcgc
tgtgactatgccctatatttgggcgcctccgatgcgaactgggcccaggcccacgaattg
gcctcgcaggcgtgtggcctgaagatgtacctcaacgacacgtacggcacactgaggctc
agcgatatgacggcctggcagcgacacctctcacactggcccaaacgggccccgatcgtt
tgccacgcggagaagcagagcatggcggctgtggtgctgctggcacatctgctggatcgc
catgtgcacatttgtcatgtggccaggaaggaggagatccagctgattcgggcggccaag
gagaagggcatcaaggtaacgtgcgaggtgtgcccgcaccacttgttccttagcaccaaa
gatgtggatcgtctgggctccggcatgtccgaggtgcgtccgctcctctgctcacccgaa
gaccaggaggcgctgtgggagcacatggagtacatcgatgtgttcgccaccgaccatgca
ccgcacacgctcgaggagaagcaatcggagcgtccaccgcccggctttcccggcctggag
accatcctgccgctcctactgcaggccgtccacgagggccggctaaccatggaggatatc
aaacgcaagctgcaccgcaatccgcgcaacatcttcaacctgcccgagcagccgcacacc
tatgtggaggtcgatctggacgaggagtggaccatctccggcagcgagctgaagaccaag
gccggctggacgcccttcgaggggaccaaggtcacgggtcgtgtccatcgcgtggtcctg
cgcggcgaggtggccttcatcgacggccaggtgctcgtgcagcccggcttcgggcagaat
gtccgcaacaaagcgggcgcccagcagctgctctccgaggccacccaggagctgcccagc
gatagggacgccaacgacacctttgcccgcctcctgactgtggagggtgccgcgaaggtc
cactttgtggacgaggccaacaattcaaacagcttcctgcggccgatctccccgtcgccg
cgccaccgcctggactcgtccagcaacaccaccctgagggactacctgcagcggaccgcc
atgtctgtgtctggatcggcatcggggtcggtggcggccaaccagtactctcagcccagt
cccaacccggtggcccattcgctggtgggcaagcacatcctggccgtggacatgttcagc
aaggaccacctaaacgacatcttcaatctggcgcagctgctcaagtcgcgtgtgaccaag
gaccggccgttggacgatctgctgcgcggcaagatcatggccagcgtcttctacgaggtg
agcacacggacgcagtgcagctttgccgccgccatgctccgactgggcggacgggtgatc
agcatggatcagctgacatcgtcggtgaagaagggcgagtccctggaggacagcatcaaa
gtgatggccagctatgcggatgtcatggtgctgcgccatcccctacccggagctgtggct
cgtgccgccttgtactcccgcaagccggtgatcaatgctggcgacggcgtcggggagcat
cccacccaggcactgctggacatattcaccattcgggaggagatcggcaccgtaaacggg
ctcaccatcaccatgtgtggagatctgaaaaatggtcgcaccgtccactcgctggcacgt
ctcctcaccctctacaatgtgacgctgcagtatgtggcgcccgagactctccagatgccg
gacgaaatcaccaagtttgttaatgagcggggcgtcaaacaggtgttctacaacgccctg
gccctggacgctctggccgacaccgatgtgctctacatgacgcgtatacagcgcgagcgc
ttcgacagcgacagcgagtatcagaagtgcaacggtcccttcattgtcacgcccaagctg
atgactctggccaaaaagcgtatgattgtgctccacccgttgccgcgtctggacgagatc
agtcgcgactttgacttggatccgcgcgctgcctacttccggcaggccgagtacggtatg
tacatccgcatggctctgctggccatggtcgtcggatgccgcagcacggctctctaa

DBGET integrated database retrieval system