KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15093Help
Entry
Dpse_GA15093      CDS       T01032                                 

Definition
GA15093 gene product from transcript GA15093-RA (EC:3.-.-.-)
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dpse_GA15093
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dpse_GA15093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 216 aa AA seqDB search
MSAPVIVEATAKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDISGPEDEPGIQAARDNVHGMIQKEISAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKKFPGAKLNSEDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWVN
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccggtcattgtcgaggccacggccaagcaaactgccacgttgattttcatg
cacggcctgggggatactgggcacggctggagcagtgcattggccgccatcagacctcct
ttcatgaaggtgatctgtccgacagccccaacacagccagtgtcgctaaatgctggcttc
cgcatgccctcctggtttgacctgaagacgctggacatttccgggcccgaggatgagccc
ggcatacaggcagcgcgcgacaatgttcacggcatgattcagaaggagatcagcgctggc
attccggccaatcgcatcgtcttgggcggcttttcgcagggcggagccctagctctctat
tcggcgctgacctatgaccagccgctagccggcgttgtggcactctcgtgctggttgccg
ctgcacaagaaattccctggagccaagctgaacagtgaggatgtgccgattttccaagcg
cacggtgactacgacccggtggttccctacaagtttggccagctaagcgccagtctactc
aagtcgttcatgaagaacgtgaccttcaagacatacagtggactctcgcactcgtcgtcc
gatgacgagatggacgacgtgaaggacataatcagtaaatgggtaaactaa

DBGET integrated database retrieval system