KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15099Help
Entry
Dpse_GA15099      CDS       T01032                                 

Definition
GA15099 gene product from transcript GA15099-RA (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpo00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 287 aa AA seqDB search
MTSRQRTVIIFKSESDSTDVYAETLLGHNFNPVFVPTLCFGFKNLQELGNKLQTPDKYAG
IIFTSPRCVEAVNEALLLGELPGGWKLLHNYAVGEVTHNLALSTLQQLFTHGKQTGNARN
LGEYIVDTFDGSRDLPLLLPCGNLATDTLLSKLAENGFCVDACEVYETKCSPQLGECVER
ALKEAGDSVEFLAFFSPSGVACAMEYFRAHNISLEPWKLVAIGPSTRRALESQGQKVYCT
AERPTVEHLVKVLLNPQDSRERLVREREQMQELERAAVAAAAALENN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccgccagcggacggtgattattttcaaatcggaatcggatagcaccgatgtg
tacgcggagactctgctggggcacaacttcaatccggtgttcgtgccgacgctgtgcttc
ggcttcaagaacctgcaggagctgggcaacaagctacagacgccggacaaatacgcgggc
atcatcttcaccagtccacggtgcgtggaggccgtcaacgaggcgctgctgctgggcgaa
ctgccaggtggttggaagctgttgcataactatgccgtcggcgaggtgacccacaacctg
gccctcagcacgctgcagcagctcttcacgcacggcaagcagacggggaatgcccgcaac
ctgggcgagtacattgtggacacgttcgatgggtcgcgcgatctgccgctgctgctgccg
tgcggcaatctggccaccgacaccctgctctcgaagctggccgagaacggcttctgtgtg
gacgcctgcgaggtctacgaaacgaagtgtagcccccagctgggcgagtgcgtggaacgg
gcactgaaggaggccggcgacagcgtcgagtttctggccttcttctcgccctcgggcgtc
gcctgtgccatggagtacttccgggcgcacaacatttcgctggaaccctggaagctggtg
gccatcgggccgagtacacggcgtgccctggagtcgcagggccagaaggtctactgtacc
gccgagcggccgacggtggagcatctggtgaaggtgctgctcaatccgcaggacagcagg
gagcggctggtgcgtgagcgggagcagatgcaggagctcgaacgggctgcggtagccgcc
gccgctgccctggaaaacaattag

DBGET integrated database retrieval system