KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15103Help
Entry
Dpse_GA15103      CDS       T01032                                 

Definition
GA15103 gene product from transcript GA15103-RA (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerophospholipid metabolism
Lysosome
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:dpo00564]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dpo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 426 aa AA seqDB search
MRLRSGILLVVLLTIFLEVADCSWPWPFSRKHKQNMPPPPPTPPPEPKMSPVIFVPGDGG
SQLDARLNKSSAPYFVCEKTHDWFNLWLDLEQLVIPMVYCWIDNVKLYYDKATRTTHNTP
GVETRIPGWGNPEVVEWIDPTRNSAGAYFKDIVNVLVGMGYERKLNIRGAPFDFRRAPNE
NKQFFIDLKQLVEETYEVNNQSAVTFISHSMGSPMTLVFLQQQTLEWKNKYVRRQISLAG
AWAGSVKAVKVFAMGDDLDSFALSAKILRAEQITHPSSAWLLPSPLFWKPSDVLATTPSR
NYTMAQLKEFFNDIDYMTGWEMRKDTLRYTQNFSPPDVELHCLYGDGIDTVERLQYKKND
IAGETPKLIMGPGDGTVNQRSLRACKYWSGYTSSPISTLALQGVDHMKILSHEDVLQYIR
TVMQQP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagactccgctctggtatcctcctggtggtgctactgaccatctttttggaagtagcg
gactgctcgtggccctggccattttccaggaagcacaagcagaatatgcctccgccgccg
cccacgcccccgccagagcccaaaatgtccccagtaatatttgtgccaggtgatggcgga
tcccagctcgatgcccgcttgaacaagtcgagtgctccctacttcgtgtgcgagaagacc
catgactggttcaatctctggctcgacctggagcagctggtgattccaatggtgtactgc
tggatagacaatgtcaagttgtactacgacaaggccactcgtacaacgcacaataccccg
ggagtggagacacgcatacctggttggggcaatcccgaggtggtggagtggatagatccg
acgcggaacagtgcaggagcgtatttcaaagacatcgtaaacgtgcttgtgggcatgggc
tatgagcggaaactgaacatacgcggagcaccctttgacttccgcagagcaccaaatgag
aacaaacagttcttcatcgacctcaagcagcttgtcgaggagacctacgaggtgaacaac
cagtcagccgtcaccttcatatcgcacagcatgggcagtcccatgacactagttttcctg
cagcaacagaccctcgagtggaagaacaagtatgtgcggcggcagataagtctcgccggc
gcgtgggctggcagcgtaaaggcagtgaaagtctttgctatgggcgatgatctggactcg
tttgctctgagtgccaagatcctgagggctgagcagattacgcatccttcgtcggcctgg
ctactgccatcaccgttgttctggaagccatccgatgttctggccacgaccccctctcgt
aactatactatggcacagctcaaagagttcttcaacgacattgactacatgacgggctgg
gaaatgcgcaaggacacgttgcgctatacccaaaacttcagtccccccgatgtggagctg
cactgcctatacggcgacgggatagacacagtggaaagattacagtacaaaaagaacgat
attgctggagaaacgcccaagctgatcatgggtccgggcgatggcactgtgaaccagcga
tccctacgggcctgcaagtactggtcgggctacacgagctcccccatatcgacgctggcc
ctgcagggagtggaccacatgaagatcctgtcgcatgaagatgttctccaatatattcgc
actgtcatgcagcagccgtag

DBGET integrated database retrieval system