KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15146Help
Entry
Dpse_GA15146      CDS       T01032                                 

Definition
GA15146 gene product from transcript GA15146-RA (EC:3.1.2.15)
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA15146
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA15146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 2812 aa AA seqDB search
MTFDTRRQTTGQPTSSATTTATTTTITTSTSSMPSSAGSSAGGGSSAGGGIDTTSSSSGG
GGGGGNNQEQTPASTSADADNVVGSSSVSSVDSIVTIVSPEKLISSFPTTKLRSLTQKIS
NPRWVVPVLPEQELEVLLNAAIELTLAGVDHDCEPCVEFYRNGLSTSFAKILTDEAVNSW
KYNIHHCILVSCGKLLHLIAIHMVRDNPYLLDLLAIVFDPENKFNAFNAARQPECFATPD
CIWGQLDSNKMYARPPPEPKSARGWLVDLINRFGQLGGFDNLLERFNKGLELLKRNQNKV
PSIKSGGSSSSEGEEGGQDNRLTLAVIHSLLRPFGQCHELLTPATIAKYFMPTWNVVLDL
LDSFTDEELKREVKPEGRNDYINGIVKSARFLASRLSGQEDLIRDLEMFRLKMILRLLQV
SSFNGKMNALNEINKVLSSVAYYSHRSQPLPHSLPEDDMDWLTAERMAQWIKASDVLGIV
LKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWD
FTPEQLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSKE
VPPEVLDQALGAHVKILDYSCSQERDAQKTIWLDKCVGELKAGDSWVLPALRLIRDICCL
YDTTPNHAPRTQTSTNRQQVIERLQNDYSLVILVTNSLTAYMEKVRQLVAETPGLEPAAI
LIDNRFPHQAQISERLEFLKFLLKDGQLWLCADQAKQIWHCLAVSAVFPSDREECFRWFG
KLMGEEPDLDPGINKDFFENNILQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHRGYI
LDNEDLIGKDYLWRVITTGGEEIASKAIDLLKEVSTALGPRLLENISEFHEMFIGECCSR
LRTHYGNIVILGNTQLQEEADDPNNQADNSNDSKDTKMRFIEAEKMCRIIKVLQEYIKEC
DRSFSGDRIHLPLSRVTRGKNTSLYIRFQNPGRPIDDLEIVTHSNETVAAFKRNLLKRIK
GTSTTNIKVDLFYTNGEMIEVSDEINPLYQYTIRDKMILTAKLTPVGSGLASSPDSSSDS
STGSPPRPCPDMQRVESESTLPGVIISQNYQYTEFFLKLYQLGSELEHGRLRDSAKVLLH
LLPCDRQTMRQLQLMCRVPKAAQEKAVAKDGEAADETAGETEGESCTPEQMFLHPTPAQV
LYNLSVLHGLLIPALEPLGESALQVQSAWMHSGCAHFVLELLTKNNFLPNADMHTKRASF
QCVLRLAKLFLYIVGSVLSRVGDEPMICDYDNGARSQVDILKQNFSSTPNSSQGTLRAIS
AKLAVMLAREMLSASQEGERCRALFSSTLQWSCPDISTIKAVVQLAWASSCGNLQALGSS
NGCDFEDEVIVPDSQDFSMCKEALEVLTISFILNPSANEALSGDANWAKFITSIVLKNPL
RHVRQVASEQLFLASTYCAGDRRPFIYMVNLLVSALKTLVPQYEATCAEFFSVLCRTLSY
GCIYNWPLQIGEDLLGDEIKWLQKIRENVKATGDTQVHEELLEGHLCLAKELMFFLVPDS
KAQLNELIHELIDDFLFTASREYLHLRRHGTLRQDTVPPPVCRSPHTIAAACDLLIALCQ
LCVPNMKLLTNTLIDFVCTDTDPLREWDYLPPVGARPSKGFCGLKNAGATCYMNSVLQQL
YMVPAVRVGILKAHGAATNDGEDFSGDSEMTTASLGAALFSGPSAAIVSFSAALAGEDES
TSVRKNYHVVILKHVQAIFAHLGHSALQFYVPRGLWTHFKLQGEPVNLREQQDAVEFFMS
LFESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEPFSVFSVDIRNHSSLTE
SLEQYVKGELLEGADAYHCDKCDKKVVTVKRLCVKKLPPVLAIQLKRFEYDYERVCAIKF
NDYFEFPRILDMEPYTVSGLAKLEGEVVEVGDNCQTNVETTKYELTGIVVHSGQASGGHY
FSYILSKNPANGKCQWYKFDDGEVTECKMHEDEEMKAQCFGGDYMGEIYDNNLKRMQYRR
QKRWWNAYMLFYTRCDQTPVPFEPSVEQLSLTESRNMVLPLPKPIERSVRHQNIRFLHSR
SIFSVEFFNFIKKLVSCSIPSARSDKITPAAEELSLLGVQLASQFLFHTGFRTKKSLRGP
VIEWYDTLSHHIRSSALVRKWFANHALLSPPSRLGEYILMAPSPEVRAVFVKLVVFFCHF
AINDDPLVGYEGTNLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVGLGTREKQQLL
KLNVPLQFMLVALDDGPGPSIKYQYPEFSKLHQVVSHLVRCSDVSDKCQSSNQTGSPQAS
PLPNPFKDSSVAHEELTPLSSECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPH
FSRAVLTELLWQCGFAYCHDMRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLDT
IQRAKTHYQKRAYQIIKCLTQLFHKSQIALQMLNTNPTISRHWSIAVEWLQDELERQRGI
GCQYNSYSWSPPAQSNDNTNGYMLERSLSAKNTWNLAYELCPEEVSEKTDQDENNESDLD
SNLDENKQEAGQQQQQPTAAQTETGTSGSDPTPENKPNAIINSDPSTWPTRIETNSIPRL
SRQLFGAYTSTGGSPFGTVAPTVICSAATTGGNTGGGTTTGSGANSETESSAQETTTVET
TANINGLTNSLDHMDISSVKKKYRKKERRRKPEENNYETAEESSAPETTAVTVPVTTTTE
VTKPKAAAVTGAADAAVTINNSSSTPTIAITAPTSSVGTTSETGAGIEKNYI
NT seq 8439 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcgatacgcgcaggcaaaccactggacagccgaccagcagcgcaactacaaca
gccacaaccaccacgatcacgacatcgacatcgagcatgccgagcagtgcgggaagcagt
gctgggggaggtagctctgccggaggtggcatagacaccaccagcagcagcagcggcggc
ggtggcgggggcggcaacaatcaggagcaaacgccggccagcacaagtgcagacgctgac
aatgtggtcggatcgtcgtcggtcagcagtgtggacagcatcgtcacaatagtgtcacca
gagaagctgatatcatcgtttcccacaaccaaactgcgatcgctgacccaaaagatatcc
aacccccgatgggtggtgcccgttctgcccgagcaggaactagaggtgctcttaaatgca
gccattgagctgaccctagccggcgtggatcacgattgcgagccgtgtgtggagttctat
cggaatgggctgagcacttcgtttgcaaagatcttaacggatgaggctgtcaactcgtgg
aagtacaacatccatcattgtatcctggtgtcctgcggcaagctgttgcatctcattgcc
atacacatggtgcgtgacaatccctacctgctcgatctgctggccattgtcttcgatccg
gagaataagttcaatgcgttcaatgcggctcgccagccggaatgctttgcgacgcccgac
tgcatctggggacagctggacagcaataagatgtacgcgaggccgccgccagagccgaag
agtgcacgcggctggcttgtggatctcattaatcgcttcggacagctgggtggcttcgac
aatctgcttgagcgattcaacaagggtctggagctgttgaagcgtaaccaaaataaggtt
ccctccatcaagagtggcggatcctcctccagcgagggcgaggagggcggacaggacaat
cgtttgactctggcggtgatacacagccttttgcggccgtttggccagtgtcacgagctc
ctcacgcccgccaccattgccaagtactttatgcccacttggaatgtggtcctcgatctg
ctggacagcttcaccgacgaggaactgaagcgcgaggtgaagcccgaggggcgcaacgac
tacattaatggcattgtaaagtcggcgcgtttcctggcgagccgcctgtccggccaggag
gacctgatacgcgacctggagatgttccgcctgaagatgatccttcgcctgctgcaggtc
tccagcttcaatggcaaaatgaatgccctgaacgagatcaacaaggttctgtcctcggtg
gcctactactcgcatcgctctcaaccactgccacactccctgcccgaggacgatatggac
tggctgacggcggagcgcatggcccagtggatcaaggcatccgatgtgctgggcatcgta
ctcaaagactcgctgcatcagccgcagtatgtggaaaagctggagaaaatcatacgcttc
ctgatcaaagagcaggccctaacgctggacgatctggatgccgtgtggcgtgcccaggcg
ggtaagcacgaggccatcgtaaagaacgtgcacgatctgttggccaaactggcctgggac
ttcacgcccgaacagctggatcatctcttcgaggcgtttcaggccagcatgacgacggcc
aacaagcgtcagcgagagcgtctgctggagcttatccggcgcttggccgaggacgataag
aacggtgtgatggcccagaaggtgctcaagctgttctggacgctggcccacagcaaggag
gtgccgccggaggtgctcgaccaggccttgggggcgcacgtcaagatcctcgactacagc
tgctcgcaggagcgcgacgcccagaaaaccatttggctggacaagtgcgtgggcgagcta
aaggccggcgattcgtgggtgctgcccgccctgcggctgatccgtgacatctgttgcctg
tacgacacgacgcccaatcatgcgccgcgcacgcagacgtccaccaaccgccagcaggtg
atcgagcggctgcagaacgactactctttggtcatcctggtcaccaacagcctcaccgcc
tacatggagaaggtgcgccagctggtggccgagacgccaggcctggagcccgccgcgata
ctgatcgacaatcggtttcctcatcaggcgcagatctccgagcgcctcgagtttctcaag
ttcctgctgaaggacgggcagctctggctgtgcgccgatcaggcgaaacagatctggcac
tgtctggcggtgagcgcggtgtttccgtcggatcgcgaggagtgtttccgctggttcggt
aaactgatgggcgaggagccggaccttgatccgggcatcaacaaggacttcttcgagaac
aacatcctgcagctggacccgcatctgctcacggagagcggcatcaagtgcttcgagcgg
ttcttcaaggccgtcaactcgaaggaggacaagttgaaggccatccatcggggctatata
ctagacaacgaggatctcattgggaaggactatctgtggcgcgtgataaccaccggcggc
gaggagattgccagcaaagcaatcgatctcctgaaggaagtgtccaccgccctgggcccc
cgactgttggagaacatttccgagttccacgagatgttcatcggcgagtgctgctcgcgc
ctgcgcacccactatggcaacattgtgatcctgggcaacacgcagctgcaggaggaggcg
gacgaccccaacaaccaggcggacaactcgaacgactcgaaggacacaaagatgcggttc
atcgaggcggagaagatgtgccgcatcatcaaggtgctgcaggagtacattaaggaatgc
gatcgctcgttcagtggcgatcgcatccacctgcccctcagtcgcgtgacgcgtggcaag
aacactagtctgtacatccggttccagaatcccggacgacccattgacgacctcgagatt
gtgacgcacagcaacgagacggtggcggccttcaagcggaatctactgaagcgcatcaag
ggcacctccaccaccaacatcaaggtggatctgttctacaccaacggggagatgatcgag
gtctccgacgagatcaatcccctctaccagtacacaatacgcgacaagatgatcctcacc
gccaaactcacgcccgtgggctctggcctcgccagcagcccggactcctccagcgactcg
agcaccggctccccgccacggccctgccccgacatgcagcgcgtggagtctgagagcacc
ctgcccggggtgattatctcccagaactatcagtacacggagttctttctgaagctctat
caactgggaagcgagctggagcacggtcgcctgcgggacagtgccaaggtgctgctgcat
ctgctgccctgcgacaggcagaccatgcggcagctacagctgatgtgtcgcgtgcccaag
gcagcacaagagaaggcagtcgccaaggacggggaggcggcagatgagacggcaggcgag
actgaaggggagagctgcacccccgaacagatgttcctgcatccgacgcccgcccaagtg
ctctacaaccttagtgtgctgcatggcctgctgatacccgctctggagccgctgggagag
tcggcgctgcaggtgcagtccgcctggatgcactcggggtgcgcccactttgtgctggag
ctgctgaccaagaacaactttctgcccaacgccgatatgcacacgaagcgcgcctccttc
cagtgcgtgctgcggctggccaaactgttcctctacattgtcgggagcgtgctgtcgcgc
gtgggcgacgagccgatgatctgcgactatgataatggagcccgctcccaggtggacata
ctgaagcagaacttttcgagcaccccgaacagttcgcagggcacgctgcgggccatttcg
gccaagctggcggtgatgctggcccgggagatgctctccgccagccaggagggcgaacgc
tgccgcgcgctcttcagctccacgctgcagtggtcctgtccggacatctccaccattaag
gcggtggtgcaactggcctgggcctcctcctgcggcaatctgcaggccttgggcagcagc
aacggctgcgattttgaggacgaggtgatcgtgccggacagccaggactttagcatgtgc
aaggaggccctcgaagtgctcaccatctcgttcattcttaatccgagcgccaacgaggcg
ctcagcggcgatgccaattgggcgaaattcatcacctccattgtgctgaagaatcccctg
cggcacgtgcgacaggtggcctccgagcagctgttcctcgcctccacctactgtgccggc
gatcgccgtccgttcatttatatggttaatctgctggtgagcgccttgaagacgctggtg
ccccagtacgaggccacctgcgccgagttcttttcggttctgtgccgcactctgtcctac
ggttgcatctacaactggcccctgcagattggcgaagatctgctgggggacgagatcaag
tggttgcagaagatacgcgagaatgttaaggccacgggcgacacccaagtgcacgaggag
ctgctcgagggacacctgtgcttggccaaggagctgatgttcttcctggtgcccgactcg
aaggcccagctcaacgaactgatacacgagctcatcgatgactttctgtttacggcatcg
cgtgaatatctgcatttacgacgacacggcaccctcaggcaggacaccgtaccaccgccc
gtctgccgcagtccacacacaatagcagccgcttgcgatctcctcatagccttgtgccag
ctctgtgttcctaatatgaagctactcaccaatacactcattgatttcgtctgcacggac
accgatccgctgcgcgaatgggactacctgccgccggtgggcgccaggcccagcaaaggt
ttctgtggtctgaaaaacgctggggccacctgctacatgaactcggtgctgcagcagctc
tatatggtgccggcggtgcgcgtgggcatactgaaggcccatggggcggccaccaacgat
ggcgaggacttcagcggtgattcagagatgacaactgccagcctgggggcggcccttttt
tcgggcccctctgcggcgattgtatcgttttcggccgccctcgctggggaggatgagtcc
acgtccgtgcgcaagaactaccatgtggtaatcctgaagcatgtccaggccatattcgcc
catctcggccacagtgcactgcagttctatgtgccacgcggtctctggacgcatttcaag
ttgcaaggcgagccagtgaatctgcgcgaacagcaggatgccgtggagttcttcatgtcc
ctgtttgagagcctcgacgagggcctcaaggcattggggcagccgcagctgatgaacgcc
acgctgggcggatcgttcagcgaccagaagatctgtcaagagtgcccgcatcgctactcc
aaagaggaaccatttagtgtatttagtgtcgatattaggaatcatagctcattaaccgaa
tctctggagcagtacgtcaagggggagctgctcgagggagccgatgcataccattgtgat
aaatgtgataaaaaagtagttaccgttaagcggctatgtgtgaagaagctgccacccgtg
ttagccatacaattgaagcgctttgaatacgactacgagcgcgtctgtgcgattaagttt
aatgattattttgaatttcctcgtatcctggatatggagccctacacagtttctggccta
gctaagctcgagggcgaggtggtggaggtgggtgataattgtcaaacaaatgttgaaaca
acaaaatacgaactgacgggcatcgtggtgcacagcggccaggcatccggcggccattac
ttcagctacatactctccaaaaacccagcgaatggcaaatgccaatggtacaagtttgac
gatggcgaggtgaccgaatgcaaaatgcacgaggacgaggaaatgaaggctcaatgcttt
ggcggcgactacatgggcgagatctatgacaacaatctaaagcgtatgcagtatcgccgc
cagaagcgctggtggaatgcctacatgctgttctacacccgctgcgatcagacgcccgtg
ccgttcgagccgagcgtcgagcaactgtcgctcaccgaaagccggaatatggtactgcca
ctgcccaagcccatcgagaggagcgttagacatcaaaacatacggtttctgcattcacgt
agcattttctccgtagagtttttcaattttatcaaaaagcttgtcagctgtagtataccc
tcggcgaggagcgataagattacacccgctgccgaggagctgtccctgttgggcgttcaa
ttggcatcgcagtttctgttccacacaggtttccgcacgaagaagtcgctacgcggcccc
gtcattgaatggtacgatacgctttcacatcacatacgttcctcggcgctggtgcgcaaa
tggtttgccaatcatgccctgctctccccaccatcgcgtctcggggaatacatactgatg
gccccgtcgccggaggtgcgcgccgtgtttgtcaagttggttgtgttcttctgccatttc
gccatcaacgatgacccgctggtcggctacgagggcaccaatctctgcgaacaggtgctc
atcagtgtgctgcgcctgctcaagtccgaggcggccgactacggcaagcacttgccccac
tatttcagtttgttcagcatgtacgtgggtctggggactcgcgagaagcagcagctactg
aagctcaatgtgccgctgcagttcatgctggtggcgctggacgatgggcctggtccgtcc
atcaagtaccagtatccggagttcagcaagctccatcaggtggtctcgcatctggtgcga
tgcagcgacgtgagcgacaagtgccagagctccaatcagacgggcagtccacaggccagt
cccctgcccaatcccttcaaggactccagtgtggcccacgaagagctaacgccgctgtcc
agcgagtgcatggaccttctctttaacagaacaggatacatcaagaaagtaatcgaggac
acgaacgtgggcgatgaggggctgaagctgctccagtactgcagttgggagaatccgcac
ttttcacgggccgtcctcaccgaactgctgtggcagtgtggcttcgcctactgccacgat
atgcgccaccacacggatctgctgctgaacattctgctgatcgacgactcctggcagcac
catcgcatccacaacgccctcaatggcgtcgccgaggagcgggagggcctgctggacacg
atacagcgggccaagacgcactaccagaagcgcgcgtatcagatcatcaaatgcctgacg
cagctcttccacaagtcccagattgccctgcagatgttgaacacaaatccgaccatctcg
cgccactggagcattgcagtagagtggctgcaagacgagctggagcggcagcgcggcatc
gggtgtcagtacaactcgtactcgtggtcgccaccagcacagagcaacgacaataccaac
ggctacatgctggagcgatcgctgtcggcaaagaacacctggaacctggcctacgagctc
tgtccggaggaggttagcgagaagacggatcaggatgagaataacgaatccgatttggac
tccaatctggatgagaacaagcaggaggcgggacagcagcagcagcagcccacggctgcg
caaacggagaccggtacgtccggctctgatccgacgccagagaacaagccgaacgccata
atcaacagtgacccatcgacgtggccgactcgcatcgagaccaattccattccgcgtctg
tcacgccagctctttggggcatacacatcgacgggaggcagccccttcggaacggtggca
cccactgttatctgctccgccgccaccactggaggaaacactggaggtggcacgacgact
ggcagcggggcaaacagcgagacggagagcagtgcccaagagacgaccacagtggagacc
acggcgaacataaacgggctgaccaacagcctggatcacatggatatatcatcagtgaaa
aagaagtatcgcaagaaagaaaggagaagaaagccagaggaaaataattacgagacggca
gaagagtcgtcggcgcctgagacaacagcagtcacagtcccagtaaccacaactacagag
gtcacaaaaccgaaggctgcagccgtcacaggagcagcggatgcggcagtcacaatcaac
aacagcagcagcacgcccacaatagcgataacagcgccaacgagcagcgttggcacaacg
tcagagacgggagctgggatagagaaaaactatatatga

DBGET integrated database retrieval system