KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15172Help
Entry
Dpse_GA15172      CDS       T01032                                 

Definition
GA15172 gene product from transcript GA15172-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dpse_GA15172
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dpse_GA15172
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dpse_GA15172
  Exosomal proteins of breast milk
   Dpse_GA15172
Heparan sulfate/heparin binding proteins [BR:dpo00536]
 Enzymes (General comment) Variety
  Dpse_GA15172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 419 aa AA seqDB search
MPGTCHVFRRQTLPPPLVLLLAGLLLLGDGIAVQGLHRHSIMMKTFRYLQETMLRNSLER
AHLNHGIVFECRTISDRDFGNEVHFLLQLGDLRGFRQLDASKKLALFLHGWNDKGSKDWV
QELLLTWTLFDASYNVCVVDWGNLSQNDYKTASMSIFDVGLTVAGIIMALEELRPSQFHR
SNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVSPKYRLDPSDAKFVQ
VLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFMNLRDMQNTNPIACSHSAAAIFFRQ
SMDPQYPFVGYECGSYREFAAGYCDQNRRARFGIHSQRRAQGSFYFTTASQQPYVQRRLG
GWLSGVGRQVDSTSASGQKKNGPGQLMLRLWTSGWRRGAGRTRDRRRDRSRQRDLCRWQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcacgtgtcacgtgttccgccggcagaccttgccgcctcctctggtgctgctc
ctcgccggcctgctgctcctcggcgatggcattgctgtgcagggcctccaccgccacagc
atcatgatgaaaaccttccgctatctgcaggagaccatgctgcggaacagcctggagcgg
gcccatctcaatcatggcattgtctttgaatgccgcaccatttcggacagggactttggc
aacgaggtgcacttccttctgcagttgggggatcttcggggcttccgacagctggatgcc
tccaagaagctggccctcttcctgcatggctggaacgacaaaggcagcaaggactgggtg
caggagctgttgctgacatggaccctatttgatgccagctacaacgtgtgcgtcgtggac
tggggcaatctgtcgcagaacgactacaagaccgcttcaatgtccatcttcgatgtgggc
ctgacggtggccgggatcatcatggccctggaggagctgcgtcccagccagttccatcgc
agcaacgttaccctggccggctacagtctgggggcccatgcagccggctatgccggagcg
gtgctcgagggccaggtggagcagatcatcggcctggatccggccggaccgctcttctcg
ctgcccgccgaggtctcgcccaagtaccggctggaccccagcgacgccaagttcgtgcag
gtgctgcacacctccggcggctccttggggacgagcctcaagtgcgggcatgccgacttc
tatccgaacggtggccgggcaccgcagacgaactgcaagatgttcatgaatctccgcgac
atgcagaacacaaatcccattgcctgcagccattcagcggctgccatctttttccgacag
tcgatggacccgcagtaccccttcgtgggctacgagtgcggcagctaccgggagttcgcc
gccggatattgcgaccagaaccgacgggcccgtttcggcatccactcgcagaggagggcg
caggggagcttctacttcacgaccgcctcccagcagccctacgtgcagcggcggctggga
ggttggctgagcggcgtggggcggcaggtggactccacctccgcctctggccagaagaag
aatggtccaggtcagctcatgctgcgcctctggacgagcggttggcggaggggcgccggt
cgcactcgggaccggagacgagaccggagccgacaaagagatctgtgtcggtggcagtag

DBGET integrated database retrieval system