KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15172Help
Entry
Dpse_GA15172      CDS       T01032                                 

Definition
GA15172 gene product from transcript GA15172-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerolipid metabolism
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dpo00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 419 aa AA seqDB search
MPGTCHVFRRQTLPPPLVLLLAGLLLLGDGIAVQGLHRHSIMMKTFRYLQETMLRNSLER
AHLNHGIVFECRTISDRDFGNEVHFLLQLGDLRGFRQLDASKKLALFLHGWNDKGSKDWV
QELLLTWTLFDASYNVCVVDWGNLSQNDYKTASMSIFDVGLTVAGIIMALEELRPSQFHR
SNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVSPKYRLDPSDAKFVQ
VLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFMNLRDMQNTNPIACSHSAAAIFFRQ
SMDPQYPFVGYECGSYREFAAGYCDQNRRARFGIHSQRRAQGSFYFTTASQQPYVQRRLG
GWLSGVGRQVDSTSASGQKKNGPGQLMLRLWTSGWRRGAGRTRDRRRDRSRQRDLCRWQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcacgtgtcacgtgttccgccggcagaccttgccgcctcctctggtgctgctc
ctcgccggcctgctgctcctcggcgatggcattgctgtgcagggcctccaccgccacagc
atcatgatgaaaaccttccgctatctgcaggagaccatgctgcggaacagcctggagcgg
gcccatctcaatcatggcattgtctttgaatgccgcaccatttcggacagggactttggc
aacgaggtgcacttccttctgcagttgggggatcttcggggcttccgacagctggatgcc
tccaagaagctggccctcttcctgcatggctggaacgacaaaggcagcaaggactgggtg
caggagctgttgctgacatggaccctatttgatgccagctacaacgtgtgcgtcgtggac
tggggcaatctgtcgcagaacgactacaagaccgcttcaatgtccatcttcgatgtgggc
ctgacggtggccgggatcatcatggccctggaggagctgcgtcccagccagttccatcgc
agcaacgttaccctggccggctacagtctgggggcccatgcagccggctatgccggagcg
gtgctcgagggccaggtggagcagatcatcggcctggatccggccggaccgctcttctcg
ctgcccgccgaggtctcgcccaagtaccggctggaccccagcgacgccaagttcgtgcag
gtgctgcacacctccggcggctccttggggacgagcctcaagtgcgggcatgccgacttc
tatccgaacggtggccgggcaccgcagacgaactgcaagatgttcatgaatctccgcgac
atgcagaacacaaatcccattgcctgcagccattcagcggctgccatctttttccgacag
tcgatggacccgcagtaccccttcgtgggctacgagtgcggcagctaccgggagttcgcc
gccggatattgcgaccagaaccgacgggcccgtttcggcatccactcgcagaggagggcg
caggggagcttctacttcacgaccgcctcccagcagccctacgtgcagcggcggctggga
ggttggctgagcggcgtggggcggcaggtggactccacctccgcctctggccagaagaag
aatggtccaggtcagctcatgctgcgcctctggacgagcggttggcggaggggcgccggt
cgcactcgggaccggagacgagaccggagccgacaaagagatctgtgtcggtggcagtag

DBGET integrated database retrieval system