KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15202Help
Entry
Dpse_GA15202      CDS       T01032                                 

Definition
(RefSeq) GA15202 gene product from transcript GA15202-RA
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 417 aa AA seqDB search
MLRLHGTGMLLVLLLLALQAFAQRWERTMTHFGNCHTADYGRGTCVDPGNCDFYDVDKLD
ASSKRQCYSRQRPDLVCCPRESNIIPALGIRINNKNNSNNNSGSTTTTERPSLRLKAGPP
PNTLPPRPPTSPDQLPQYPYCGTAFASRVFGGSVAGILEFPWTTLLEYSEEGGNKSYVCG
AAFIAQRWLVTAAHCTHVFFMGPGRRLTGARLGEWNKATDPDCITILNGRRECAPPHIRV
SIDRILPHEQFSVKNLTNDIALLRLARPVNWLQMQHVEPVCLPPGRGPLANQLVGSAVDV
SGWGRTENSESSNFKRKAMLIVQPLDECQAAFSKDGQVLNESQLCASGGIGVDSCNGDSG
GPLTVEASTPQRDRFVYLAGVVSFGREECGQTEFSGVYTRISSHMDWIEQTIRANRI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtctccacggaactgggatgctgctggtgctcctcctgctggcactgcaggct
ttcgcccagcgttgggaaaggacaatgactcactttgggaactgccacacggcggactat
ggccgtggcacatgcgtcgatcccggcaactgtgacttctacgatgtggacaagctggat
gcctccagcaagcgacaatgctactcccggcagagacccgatttggtatgctgtccgcga
gagagcaacatcatacccgctctggggatacgcatcaacaacaagaacaacagcaacaac
aacagcggaagcaccacaaccacggagcgaccctcgctgagactgaaggcaggcccccca
ccgaatacattgccgccgcgaccacccaccagcccggatcagttgccccagtatccatac
tgcggcacggccttcgcttcccgagtgttcggcggctccgttgcgggcatcctcgagttc
ccctggacgacactgctggagtactccgaggagggcggcaataagagctatgtatgcggg
gctgcattcattgcccagcgctggctggtgacggccgcccactgcactcacgtgttcttc
atgggccccggccggcggctgacgggcgcccggctgggcgaatggaacaaggccaccgat
cctgactgcataacgatcttgaacggcaggcgggagtgcgcgcccccccatatccgggtg
agcatcgatcgcatcctgccgcacgagcagttctccgtcaagaatctgaccaacgacatc
gccctgctgcgcctggccaggcccgtcaattggttgcagatgcagcacgtggagcccgtc
tgcttgccgccgggacgcgggccactggccaaccagctggtgggctccgccgtcgacgtc
tccggctggggacgcacggaaaacagcgagtcgagcaacttcaaacggaaggccatgctc
attgtgcagcccctcgacgagtgccaggcggccttcagcaaggacggccaagtgctgaac
gagagccagctgtgtgccagcggcggcattggcgttgactcctgcaacggcgactccggc
ggaccgctcaccgtcgaggctagcacaccgcagcgggatcgcttcgtctatctcgcggga
gtcgtctcgttcgggcgcgaggagtgcggccagacggagttctccggcgtctacacgagg
atcagcagccacatggactggatcgagcagaccattcgcgcgaatcgcatttag

DBGET integrated database retrieval system