KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15208Help
Entry
Dpse_GA15208      CDS       T01032                                 

Definition
GA15208 gene product from transcript GA15208-RA (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA15208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 404 aa AA seqDB search
MAQIQEYQEYLLDALEVVDFKLIRDKADINNDDLIFHPVMAHQIFGETETIFGYQDLHVR
VFYTAGPLHIYLGVEYGTRVNEVSAGEMNADDVVGTIAHSLPDGCYFINLDEFLKTLDKA
DKFQPFGEKIGEYTRPSDDGSERLFEFYQCDYKVPSFLKFFARLQTFILWFVDAASYIDT
DDAQWCYFVCYEKYKNGDGQYQYATAGYTTVYEYYAYPQNKRPRISQMMILPPFQKLGLA
TQLVETIYKYYQSQKNVVDITVEDPSEDFQRLRNFVDARFCKELKSFSRNEIVKGFSKEM
VREARETLKLNPRQVRKVYELLRLYYTNVNDDKEYRSYRLEVKKRLNAVYYKQIKDLKKM
ERHKMDTEMLRARLPNMKQRMEQLQEEYAVVEEGYKNTLAKLKA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaatccaagaataccaggagtatttgctggacgccctcgaggtggtcgacttc
aagttgatacgcgacaaggcggacatcaacaacgatgatttgatttttcaccccgttatg
gctcatcagatatttggcgagactgagacaattttcggatatcaagatctgcacgtgcgc
gtattctatacggcaggaccgttgcacatttacttgggcgtggagtatgggactcgtgta
aacgaagtgtctgccggtgaaatgaatgcagacgatgtggtcggaaccattgcacatagt
ttgccagacggctgctacttcatcaacctagacgagtttctgaagacgctggacaaggca
gacaagttccagcccttcggcgagaagatcggcgagtacacacggccctctgatgacggc
agtgagaggctattcgagttctatcagtgcgactacaaagttccatctttcttgaaattc
tttgcgcgcctgcaaactttcatactgtggttcgtggacgctgcctcatacatagacact
gatgacgcccaatggtgctactttgtttgctatgaaaagtataagaacggcgatggccag
tatcagtatgccacagctggctacacaaccgtgtacgagtactatgcctatccgcagaac
aagcggccacggattagccaaatgatgatattgccccccttccagaagctgggtctggcc
acccaactagtcgagactatatacaagtactaccaatcgcagaagaacgtggtggacatc
actgtagaagatccctcggaggactttcagcggctgcgaaattttgtagatgcgcgcttc
tgcaaggaactgaagtcattttcccgcaacgagatcgtcaagggcttcagcaaggaaatg
gtgagggaggctcgcgaaactcttaaactaaatccgcgacaggtgcgaaaagtatacgag
ctgctacgcctgtactacaccaatgtgaatgatgacaaggagtacagaagctatcgtctg
gaggtaaagaaacgccttaatgcagtttactataagcagatcaaggaccttaagaaaatg
gagcgccacaagatggacaccgaaatgctgcgagctcgattgcccaacatgaagcagcgc
atggaacagcttcaggaagagtacgccgtggtcgaggagggctacaagaacactcttgcc
aagctaaaggcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system