KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15281Help
Entry
Dpse_GA15281      CDS       T01032                                 

Gene name
Dpse_Tpi
Definition
(RefSeq) GA15281 gene product from transcript GA15281-RD (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dpse_GA15281 (Dpse_Tpi)
   01230 Biosynthesis of amino acids
    Dpse_GA15281 (Dpse_Tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dpse_GA15281 (Dpse_Tpi)
   00051 Fructose and mannose metabolism
    Dpse_GA15281 (Dpse_Tpi)
   00562 Inositol phosphate metabolism
    Dpse_GA15281 (Dpse_Tpi)
Enzymes [BR:dpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dpse_GA15281 (Dpse_Tpi)
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dpse_GA15281 (Dpse_Tpi)
  Exosomal proteins of bladder cancer cells
   Dpse_GA15281 (Dpse_Tpi)
  Exosomal proteins of melanoma cells
   Dpse_GA15281 (Dpse_Tpi)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 335 aa AA seqDB search
MIQIVRATRGRGRSVWHTHQSGPLSRAIMDNNPSADISVDLRLSVSSKAHKPTAVFPKLS
KRPSEGQKKVSKLLSEILYANFSTNSKMSARKFCVGGNWKMNGDQKSIAEICKTLSGAAL
DPNTEVVIGCPAIYLMYARNLLPCTVGVAGQNAYKVAKGAFTGEISPSMLKDIGADWVIL
GHSERRAIFNESDELIAEKAEHALAEGLKVIACIGETLDEREAGKTNEVVARQMCAYAKK
VRDWTNVVVAYEPVWAIGTGKTATPEQAQEVHAFLRQWLTDNISKEVSAALRIQYGGSVT
AANAKELAKKPDIDGFLVGGASLKPEFVDIINARQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaattgtacgcgcgacccgtggaagaggaagaagcgtctggcacacgcatcag
agtggcccgctgtcccgcgcaatcatggacaacaacccgagcgctgacatatcggtggac
ttgcgcctgagcgtttcatcaaaagctcacaagccaacagctgttttcccaaagctttca
aagcgcccgtcggaaggtcagaagaaggttagcaaacttcttagcgaaattctctacgca
aacttcagcacaaacagcaaaatgagcgcccgaaaattctgcgtgggaggcaactggaag
atgaacggcgaccagaagtccattgcggagatctgcaagactcttagcggtgccgctttg
gaccctaacactgaggtggtcatcggctgcccggccatctacctgatgtacgcccgcaac
ctgctaccctgtaccgtgggcgtggcgggccaaaacgcatacaaggtggccaaaggagcc
ttcacgggggagatctctccatccatgctcaaggatatcggggcggactgggtcatcctg
ggccactctgagcgtcgcgccatcttcaacgagtccgacgagctgatcgccgaaaaagca
gagcatgctctggccgaaggtctaaaggtaatcgcctgcatcggtgagacactggatgag
cgcgaggctggtaagaccaacgaagtcgtcgcccgtcagatgtgcgcctatgccaagaag
gtgcgcgactggaccaacgtggttgtcgcctacgagcctgtgtgggccatcggcactggc
aagactgctacccccgaacaggctcaggaggtgcacgccttcctgcgccagtggctgacc
gacaacatatccaaggaggtttccgccgcgttgcgcatccagtacggtggctctgtgacc
gcagccaacgccaaggagctggcgaagaagccagacatcgacggcttcctagtcggcggt
gcttccctgaagcccgaatttgttgacatcatcaacgccagacaataa

DBGET integrated database retrieval system