KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15298Help
Entry
Dpse_GA15298      CDS       T01032                                 

Definition
(RefSeq) GA15298 gene product from transcript GA15298-RC (EC:2.7.-.-)
  KO
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dpse_GA15298
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Dpse_GA15298
    2.7.1.82  ethanolamine kinase
     Dpse_GA15298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 560 aa AA seqDB search
MRQRICGNNKTLKRRQEQQQEIVENCCLSKRCKYDNIWQHFKRNATLEEIRHAAARICRD
YLTGRWKVVTPESLVVKRISGGLSNFLYYVSLPDSDADENENEEQRLLEQQANGHVAKDN
VIVADAGATNIVSKNSPDFARNGAEVEVESESVGGAADDDDAATSAKQAHKRQRFDSDSG
DSSSLKRLHAPKQEPREVLLRIYGQTHGDHALESMITESVVFALLSERNFGPKLHGIFPG
GRIEQYLPARALATAELAEQRILLKVAEKMGEIHSLNIPMSKEPDWIWNCMQRWVTSFES
IVKGKIQSKPDSAVLQKQRELMRTIDYVQEIAWLRSVIESGEYPVVFCHNDLQEGNILLR
QATPERTPRESISSLRSNFDETLGDSLDGNSNLSEPEVNKSHSSSSSCPELLDTTDDSAL
DTSFTNDNEPDLIIIDFEYCAYNYRGYDLANHFIEWTFDYTNPQFPYFHHNTSNYATAQQ
RRDFIVNYLKKYHDDENYNPTVQELENVDSEIQFFTMMSHLFWSLWSVINVTSAIEFGYW
EYGIARILEYQKLKAAFLAK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcgaatttgtggcaacaataaaacactaaaacgtcgccaagagcagcagcag
gaaattgttgaaaactgttgtctaagtaaacgttgtaaatatgataatatttggcagcat
tttaagcgaaatgcaacccttgaggaaattcgccatgcggcagcacgcatctgtcgggac
tatctaaccggtcgctggaaggtcgtaacccccgaatctttggtggtgaaacgcatcagt
ggcggtctttcaaactttttgtattacgtgagtctgcccgattcggatgcggatgagaat
gagaacgaagagcagagactattggagcagcaggcgaatggccatgttgccaaagacaac
gtcatagttgccgatgccggcgccacaaatatcgtgtccaaaaatagcccagactttgca
cgcaatggggcggaggtggaggtggagtccgagtccgtgggtggggcggcagacgatgac
gacgcagccacgagcgccaagcaggcgcacaaacgtcagcgattcgatagcgatagcggc
gattcgagttcattgaaacgattgcatgcccccaagcaggaaccccgtgaggtcctgctg
cgtatctatggccaaacccatggagatcatgcgctggagagcatgattaccgaatcggtt
gtgtttgcactgctcagtgagcgtaattttggacccaaactgcatggcatctttcccggc
ggacgcatcgagcaatacttaccggcacgtgccttggccacagcggagttggccgaacag
cgtatcctactgaaagtggcagagaaaatgggcgaaattcatagcctgaatatacccatg
tccaaggaacccgattggatctggaattgcatgcagcgttgggtgaccagcttcgagagc
attgtcaagggcaaaatccaatcgaaaccggactccgcagtgctccagaagcaaagggaa
ctgatgcggaccatcgactatgtgcaggagatagcatggctgagatcggtgatcgagagc
ggggaatatcccgtggtgttctgccacaacgacctgcaggagggaaatatactgttgcgt
caggcgacaccagagcgtacgcctcgtgaatccatcagtagcttgagatccaatttcgat
gagacattgggcgacagtttggatggaaacagcaatctgtcggagccagaagtcaacaaa
tcgcacagctcgtcctcgtcctgtcccgaactgttggacaccaccgatgattcagccctg
gacaccagcttcaccaacgataatgagccggatcttattatcattgactttgagtattgt
gcctataactatcgtggctacgatctggccaatcacttcatcgaatggacctttgactat
accaatccgcagttcccatattttcatcataatacaagcaactatgccaccgcccagcag
agacgcgatttcattgtgaattatctaaagaaatatcacgatgatgagaactataatccc
acggtacaggagctggagaatgtggactccgagatacagttctttacgatgatgtcgcat
ctgttctggagcctgtggtcggtgattaatgtgacatcagccatagagtttggttattgg
gagtacggcattgctcgaattctggaatatcaaaagctaaaggccgcctttctggccaaa
tga

DBGET integrated database retrieval system