KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15312Help
Entry
Dpse_GA15312      CDS       T01032                                 

Definition
GA15312 gene product from transcript GA15312-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dpse_GA15312
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA15312
Peptidases [BR:dpo01002]
 Metallo Peptidases
  Family M67
   Dpse_GA15312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 421 aa AA seqDB search
MSKAVNNMSMGVVEPQERMKHLSHCGNFIDVDKNQPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGNVKAEVRDINKRIKDEIMPTTEKLRAKLLAHYQRE
YEQFLANKEAERVKELEREREQERQRQRELASRQAVGSSVIPSLIPANLHVLIDDGTQPS
APDLDLLDQVVYPNDFPTGANRTNLPGSGLLLPTGDASSDKTSNSKPSFDRNQKPSYNRT
DSLLAGSLRIVHVPADTMEVFLQLAKANTSNNIETCGVLAGHLAQNQLYITHIITPQQQG
TPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEALAIV
CAPKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIQKDAHTKIKVIDLR
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaacaacatgagcatgggcgttgtggagccgcaggagcggatgaag
cacctgtcgcactgcggcaacttcatcgacgtggacaagaaccagcccgtgacgcgctac
taccgctctgggacggagatgctgcgcatggccaacgtgtacctgcgggagggcaaccac
gaaaacgccttcatcctgtacttgcgctacatgaccctattcatcgaaaagattcgccag
cacccggactatggtaacgtcaaggccgaggtgcgagacatcaacaagcgcatcaaggac
gagatcatgcccacaacggagaagctgcgcgctaaactgctggcccactaccagcgcgaa
tacgagcagttcctggccaataaggaggcggagcgcgtcaaggagctggagcgggagcgc
gaacaggaacgacagcgccagagggagctggccagtcggcaggcggtgggctccagcgtg
ataccctcgctcattccagccaatctgcacgtgttgattgacgacggtacccaaccctcg
gccccggatctcgacctgttggatcaggtggtctacccgaacgacttccccacaggagcc
aatcgcaccaacctgccgggctctgggctactgctcccaacaggagacgcgtcctccgac
aagacatccaactcgaagcccagcttcgaccgaaaccagaagccgtcgtacaaccgcacg
gattctttgctagccggttcattgcgcatcgtccacgtacctgccgacaccatggaggta
tttctgcagctggcaaaggccaacacctccaacaacatcgagacgtgcggcgtgctcgct
ggccatctggcccagaaccagctctacatcacgcacatcatcacgccacagcagcagggc
acgccggacagttgcaacacgatgcacgaagagcagatattcgatgtgcaggatcaaatg
cagctcatcacgctcggctggattcatacccatcccagccagactgctttcctgtcctcc
gtggacttgcacacgcactgttcctaccagatgatgatgcccgaggccctggccatcgtg
tgtgctcccaaatacaacaccactggtttctttatactcacgccccactacggactggac
tatatcgcccagtgccggcaatcgggcttccatccgcatccgaatgacccacccctattc
atggaggcacagcacatccagaaggatgcccacacaaagatcaaggtcatcgatctgcgc
agatag

DBGET integrated database retrieval system