KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15312Help
Entry
Dpse_GA15312      CDS       T01032                                 

Definition
GA15312 gene product from transcript GA15312-RA
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:dpo04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 421 aa AA seqDB search
MSKAVNNMSMGVVEPQERMKHLSHCGNFIDVDKNQPVTRYYRSGTEMLRMANVYLREGNH
ENAFILYLRYMTLFIEKIRQHPDYGNVKAEVRDINKRIKDEIMPTTEKLRAKLLAHYQRE
YEQFLANKEAERVKELEREREQERQRQRELASRQAVGSSVIPSLIPANLHVLIDDGTQPS
APDLDLLDQVVYPNDFPTGANRTNLPGSGLLLPTGDASSDKTSNSKPSFDRNQKPSYNRT
DSLLAGSLRIVHVPADTMEVFLQLAKANTSNNIETCGVLAGHLAQNQLYITHIITPQQQG
TPDSCNTMHEEQIFDVQDQMQLITLGWIHTHPSQTAFLSSVDLHTHCSYQMMMPEALAIV
CAPKYNTTGFFILTPHYGLDYIAQCRQSGFHPHPNDPPLFMEAQHIQKDAHTKIKVIDLR
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggctgtgaacaacatgagcatgggcgttgtggagccgcaggagcggatgaag
cacctgtcgcactgcggcaacttcatcgacgtggacaagaaccagcccgtgacgcgctac
taccgctctgggacggagatgctgcgcatggccaacgtgtacctgcgggagggcaaccac
gaaaacgccttcatcctgtacttgcgctacatgaccctattcatcgaaaagattcgccag
cacccggactatggtaacgtcaaggccgaggtgcgagacatcaacaagcgcatcaaggac
gagatcatgcccacaacggagaagctgcgcgctaaactgctggcccactaccagcgcgaa
tacgagcagttcctggccaataaggaggcggagcgcgtcaaggagctggagcgggagcgc
gaacaggaacgacagcgccagagggagctggccagtcggcaggcggtgggctccagcgtg
ataccctcgctcattccagccaatctgcacgtgttgattgacgacggtacccaaccctcg
gccccggatctcgacctgttggatcaggtggtctacccgaacgacttccccacaggagcc
aatcgcaccaacctgccgggctctgggctactgctcccaacaggagacgcgtcctccgac
aagacatccaactcgaagcccagcttcgaccgaaaccagaagccgtcgtacaaccgcacg
gattctttgctagccggttcattgcgcatcgtccacgtacctgccgacaccatggaggta
tttctgcagctggcaaaggccaacacctccaacaacatcgagacgtgcggcgtgctcgct
ggccatctggcccagaaccagctctacatcacgcacatcatcacgccacagcagcagggc
acgccggacagttgcaacacgatgcacgaagagcagatattcgatgtgcaggatcaaatg
cagctcatcacgctcggctggattcatacccatcccagccagactgctttcctgtcctcc
gtggacttgcacacgcactgttcctaccagatgatgatgcccgaggccctggccatcgtg
tgtgctcccaaatacaacaccactggtttctttatactcacgccccactacggactggac
tatatcgcccagtgccggcaatcgggcttccatccgcatccgaatgacccacccctattc
atggaggcacagcacatccagaaggatgcccacacaaagatcaaggtcatcgatctgcgc
agatag

DBGET integrated database retrieval system