KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15379Help
Entry
Dpse_GA15379      CDS       T01032                                 

Definition
(RefSeq) GA15379 gene product from transcript GA15379-RA
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 566 aa AA seqDB search
MEVQVGWQKLLKMGAKLVGHKYQQYRLATNNTVVLDTENGQVMGLQRKTLYDEELYYAFE
GIPYAKAPIGELRFRAPEPAEPWKGVLNCTTYRSKPMQRNMVMGIIEGSEDCLHLNVYAK
TLQSEQPLPVIVWIYGGGFQKGEASRDIYSPDYFMKQPVVFVCINYRLGALGFLSLKDPK
LNVPGNAGLKDQVMALRWISDNIAHFNGDPDNITLMGESAGAASTHIMMTTEQTRGLFHK
AILQSGCALSEWVESPDHQWAYRLAQQMGYKGGEKDADVLKYLTKISARQIANTDQDIIT
REEIRSFLLFAFGPVVEPYETSHCVVPVRHKDMLPHAWSNDIPVIVGGNSFEGLFSYQLL
RGDPWAQSHFHNIIPREVSEAATEEQRDELVGRLKKVYFDDEKRDKMGFFEALNIFSHRQ
IWHDLHRVVMSRLAYAPTQPTYLYRFDFDSPHFNQFRRLVCGDRIRGVSHADELSYMFYN
IISPKISKSSQEYHTIERMVGMWTAFAATGDPNCPAIAPAEWLPVERTENGVEHCLNISQ
KLEMIELPEAETLAVWDSFYTKEALY
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccaagtaggctggcagaaattgctcaaaatgggggccaagctcgttgggcac
aaataccaacagtaccggctggccaccaacaacaccgtcgtgctggacacggaaaatggc
caggtgatggggctgcaacgcaagaccctctacgacgaggagctgtactatgccttcgag
ggtataccgtatgcaaaggcacccattggagagctgcgtttccgtgcccccgagccggca
gagccctggaagggtgtgctcaactgcaccacctatcgatcgaagcccatgcaaaggaat
atggtgatggggataatcgagggttccgaggactgcctgcatttgaatgtgtatgcaaag
acgctgcagtcggagcagccactgcccgtcatcgtgtggatctatggcggtggttttcag
aagggcgaggcctccagggacatctacagccctgactatttcatgaagcagccagtagtc
tttgtttgcatcaactacaggcttggagctttgggtttccttagccttaaggaccccaaa
ctgaatgtgcccggcaatgcagggctcaaggatcaggtgatggccctgcgctggatcagc
gacaacattgcacacttcaatggcgaccccgacaacatcacactaatgggcgagagtgct
ggggccgcctccacgcacatcatgatgaccaccgaacagacgcgtggcctcttccacaag
gccatccttcagtcgggctgtgctctgagcgaatgggtggagagccccgaccaccagtgg
gcgtatcggttggcccagcagatgggatacaagggcggcgaaaaggatgcggatgtcctg
aaatatctgaccaaaatatcggcccgccagatagcaaacacggaccaggacatcatcacc
cgggaggagatacgcagcttcttgctgttcgcctttgggccagtggtggagccgtacgag
acgtcacattgtgtggtgccggtcaggcacaaggacatgctgccccatgcctggagcaat
gacattcccgtgattgtgggaggcaactctttcgagggcctcttctcgtatcagctcctg
cgcggcgatccctgggcacagagccatttccacaacatcattccacgcgaggtgagcgag
gcggccaccgaagagcagcgcgacgagctggtgggacgcctcaagaaggtctacttcgac
gacgagaagcgcgataaaatggggttctttgaggccttgaacatattctcgcatcgccag
atctggcacgatctgcatcgcgtggtcatgtcccgccttgcctacgcccccacacagccc
acctacctctatcgctttgactttgattcgccgcacttcaaccagttccgtcgcttggtc
tgcggcgatcgcatccgtggtgtgtcccatgccgatgagctctcctacatgttctacaac
atcatatcgccaaagatcagcaaatcctcgcaggaataccatacaattgaacgtatggtg
ggcatgtggacggcatttgcagccaccggagatcccaattgcccggccattgcccccgcc
gaatggctgcccgttgagcggaccgaaaacggtgtagagcattgcttgaacatcagccaa
aagctggagatgatcgagcttcccgaggcggaaacactggccgtgtgggacagtttctat
accaaagaggcgctctattag

DBGET integrated database retrieval system