KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15565Help
Entry
Dpse_GA15565      CDS       T01032                                 

Definition
(RefSeq) GA15565 gene product from transcript GA15565-RC
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dpse_GA15565
Enzymes [BR:dpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dpse_GA15565
Chromosome [BR:dpo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dpse_GA15565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1821 aa AA seqDB search
MTDVVELLNSMSSTFNSDCATTTAEGGTLLNLDLAEDKTLKWRNLANNQFACKDKDKKQS
RACDEVGSEEQATHKSGPQEELLAKQKKGAEEDKKPSKATATSAAELVPTEDIEDNVKEL
LADVVDAAAVKLEEEEAATAVEVEAKAAAAATPEGLPNANEASVEEDAPAKEEEIKVSET
AEVGTAEIEAETEAADKQEEEKRPAAAPAEAASAAEGDDDERNAEVKCIGNEAGGEEAAT
AEQEPPANGSDDNAAATTEAATSSGVADISPFTVKVEREPGNMAADGIKTETVRENDQPL
PERRAGAAPKQKELEETALTAAATASSPTPLVVNSASLSVDVDCCADATESNLMNAATAG
SNRSSDQAEATVEIPAAAASADKNEEASPGCTRRSRRTPRPSDSHIPSNRSSTPTPSPAS
ANEPQAAAEIAPPTDTETEPEAAQDVQESPTLEESSEVGNAKKESEKPPQPEDASSGVTT
ARSPPAPKRGRGRAKKIKLDAESDAAPSSETPPLIDEPVIERKPGRKRRLPEEQQDQSQG
ELVVVKTEHEEALETAAPNADLKRMRRSVRLGNRHPADGPVWEEVKTEALPLMADLLLPE
LVGISGAAAVLDEKTPPKKRGRKAKIPPVPKTEAHTSSSVSGSGNSSMSLPVINGNKRTL
ASTHGGGMGMAPAEVQLPKRSKRRIKPTPKILENDELRCEFETKHIERMTHWETAAEGDA
HFETPLPCGSSGGGGGSNSSTSRQKSDKSDNSGVDGGQHPAGTSAIKKRLFSKSLRDIEN
SGAALLAKSRMKPCPDVDQFLCDIKAARLTANRSPEERKLNKKQQRKLAKQKEKHLKHLG
LKRNNSEEASDNDSSNTDNEFVPTTRVQVGKPSVTLRLRNAAAKEQLPTTSAAAAAGAGA
RAPSLKSHPPQTTAKLARRLAVRGGAGTGQAQAVGRSAALDTEQLHSLNRSILADVPASL
DDASADADAIPTTSKLALAKCLCLCQKSSQYYARNAPDSTYCCAIDNVDEQKIGCCNELP
AEVHNLLRPSQRVGYMILCDEHKKRLHAHNCCAGCGIFCTQGKFVLCKQQHFFHPDCAQR
FILNSPYDDQQQPGGSRSGTGSKFSSPMLVLKCPHCGLDTPERTSTVTMKCQTLPVFLAT
QKYKIKPAKLTTSSHLAQFAGTGQANASAKPKGRTSSTASASTSGTKANGTSRSVKGAAV
GCRIQTINTINFEQLIPDSVMNVVLRGHVMSASGRVTTEFTSRDMYYAVQNDDLERVAEI
LAADFNVLTPIREYLNGTCLHLVAHSGTLQMAYLLLCKGASSQDFVNIVDSELRTALMCA
VMNDKCDMLNLFLQCGADVAIKGPDGKTSLHIAAKLGSVEATQLIVESYKASRNITNFLS
FIDAQDEGGWTAMVWAAELGHTDIVSLLLNQGADPNLCDNDNNTVLHWSTLHNNGLDTIT
VLLQAGADCNVQNVEGDTPLHIACRHSVTRMCIALIANGADLMVKNKAEQLPFDCIPNEE
SECGRTVGFNMQMRSFRPLGLRTLVVCADASNGREARPIQAVRNELTMSENEDEADTLMW
PDFRYITNCIIQQNSVQIDRRVSQMRICSCLDSCSSDQCQCNGASSQNWYTAESRLTSDF
NYEDPAVIFECNDVCGCNQLSCKNRVVQNGTKTPLQIVECEDPAKGWGVRALANVPKGTF
VACYTGEILTAPEADRRTDDSYYFDLEHGHCIDANYYGNVTRFFNHSCDPNVLAVRVFYE
HQDYRFPKIAFFACRDIDAGEEICYDYGEKFWRTEHRSALGCKCLADSCKYANQSPSINA
SPTEATTAEAAAAESAEPDTV
NT seq 5466 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgttgtggagttgcttaatagcatgtccagcacgttcaacagcgactgcgcc
accactaccgcggaggggggcacgctgctcaacctggatctggccgaagacaagacgctc
aagtggcgcaatctggccaacaatcagtttgcctgcaaggacaaggataagaagcagagc
cgggcctgcgacgaagtggggtcggaggagcaagccacgcacaaaagtggccctcaggag
gagcttctggccaagcagaagaaaggtgcggaggaggacaaaaagccgagcaaagcgacg
gccacgtcggcagcggaactggttccgacagaggacattgaggacaacgtcaaggaactg
cttgcggatgtggtggacgccgcggccgtgaagctagaggaagaagaagctgctacggcg
gttgaggtagaggcgaaagctgcagcagcggcaacacctgaaggcctgccgaatgcaaat
gaagcgtcagtagaggaggatgcgccagctaaagaagaagaaataaaagtatcagagaca
gcagaagtagggacggccgagatagaagcagagacagaagcagcagacaaacaggaagaa
gagaagagacccgccgcagctcccgccgaagctgcttcggcagccgagggtgacgacgac
gagcgcaatgccgaagtgaaatgcattggtaatgaagcaggcggggaggaggcggcaact
gcagagcaggagccgcccgccaatggcagcgatgacaacgccgcagccacaacagaagcg
gcaacaagcagcggggtagccgacatcagcccatttacggtaaaagtggaaagggagcca
gggaacatggctgcggatggtatcaagactgagaccgtgagggagaatgatcaacctctg
ccagagcggagggcaggagcggcaccaaagcagaaggagctggaagaaacagcacttaca
gccgcagccacagcatcatctccgactccacttgttgtcaattctgccagccttagcgtt
gacgttgactgctgcgctgacgcaacagaatcgaatttgatgaatgctgctactgctggc
agcaacagaagcagcgaccaggcagaagcaacagtagaaataccagcagccgcagcgagt
gctgataaaaatgaagaagcgtcgcctggctgtacgcggcgctcgcgtcgtactcctcga
ccctcagacagtcacatccccagcaacaggagcagcacacccactcccagtcctgcaagc
gctaacgagccacaggctgctgctgagattgcaccacccactgatacagagacggagcca
gaagctgcgcaggatgtccaggaaagcccaactctggaggagagcagtgaggtgggcaat
gcgaagaaggagtcagagaagccgccgcaaccggaggatgcctccagcggcgtgaccact
gccagatccccgccagcacccaagcggggacgaggtcgcgcaaagaagatcaaactcgat
gcagagtcggatgcggccccatctagcgagacgcccccactcatcgatgagcccgtcatc
gagcggaagccgggccgcaagcggaggctgccagaggagcagcaggatcaatcgcagggc
gagctggtggtggtgaagacggagcatgaggaggcattggaaacggctgccccaaacgct
gatctcaagcggatgcggcgcagcgttcgcctgggtaaccggcatcccgcggacggtccc
gtctgggaagaggtgaagacagaggctctgcctttgatggccgacctactactgcctgag
ctggtcggaatttcgggcgccgctgccgtgctggacgagaagacgccacccaaaaagcgc
ggacgaaaggccaagataccgccagtgcccaagacggaggcgcacacttcgtcatccgta
tcgggcagcggcaactccagcatgtcgcttcccgtgataaatggaaacaagcgcaccctg
gcctcaacccatgggggaggcatggggatggctcctgctgaggttcagctgccgaagcgc
tccaagcggcggatcaagcccacgccgaagattctggaaaatgacgagctgcgctgtgag
ttcgagacgaagcacatcgagcgcatgacccattgggagacagcggctgagggtgacgca
cacttcgaaacgccgctgccttgcggaagcagtggaggcggcggtggatccaattcctcc
acgtcgcgtcagaagagcgacaagtcggataatagcggagtcgatgggggccagcatccg
gccgggacgagtgccatcaaaaagcgcctgttctcaaagtcgctgcgcgacattgagaac
tcgggagcagccctgctggccaaaagccgcatgaagccctgcccggatgtcgatcagttc
ctatgcgacatcaaggccgccaggttgaccgcgaaccgctctccggaggaacgcaagcta
aacaagaaacagcagcgcaagctggcaaagcagaaggaaaagcacctaaaacacctcggc
ctaaagcgcaacaacagcgaggaggcctccgacaacgacagctctaacaccgacaacgag
tttgtgcccaccacccgcgtacaggtgggcaaacctagtgtcaccttgcgtctccgtaat
gccgccgccaaggagcaactgcccacaacctcagcagcagctgcagcgggggcaggggca
agggctccttcattgaaatcgcatcctccccagaccacagcgaaactggcacgacgcttg
gccgttcgtggaggggctggaacgggacaggcacaggcagtgggaagatccgcagccctg
gacactgaacagctccactcactgaacaggtccattttggcggatgtccccgcatcttta
gacgatgctagtgccgacgccgatgccattcccaccacctccaagctggcactggccaag
tgcctctgcctgtgccagaagagctctcagtactacgcccgcaacgcaccggactccacc
tactgctgcgccatcgacaacgtggacgagcagaagattggatgctgcaacgagctccct
gccgaggtgcacaacctgctccgtcccagccagcgggtgggctacatgattctctgtgac
gagcacaagaagcgccttcatgcccacaattgctgcgctggctgcggcatcttttgcacg
cagggaaagtttgtactgtgtaagcagcagcatttctttcatcctgactgcgcccagcgc
ttcatcctcaacagtccctacgatgaccagcagcagccgggcggatcaaggtcaggaaca
ggcagtaaattcagcagccccatgctggtacttaagtgcccgcactgcggcttggacaca
cccgagcgcacctccacggtgaccatgaagtgtcagaccctacccgtctttttggccacc
caaaaatacaagatcaaaccggctaagctgaccacctcttcgcatctggcccagtttgcg
ggaaccggccaggccaacgccagcgccaagccaaagggaaggacctcttccacagcatca
gcctccacttccggaacgaaggcgaacggaacatcgcgcagcgtcaagggggctgccgtg
gggtgccgaatccaaaccatcaacaccatcaatttcgagcagctgatccccgactcggtg
atgaatgtggtgctgcggggacacgtgatgtcggccagcgggcgtgtaaccacagagttc
acctcccgtgatatgtactatgcggtgcagaacgacgatctggagcgggttgccgagatt
ctagctgcggacttcaatgtgctgacaccgatccgggagtacttgaatggtacctgcctg
catctggtggcccactcgggtaccctacagatggcctacctgctgctctgcaagggggcc
agctcccaggactttgtcaacatcgtggacagcgagttgcggacggcgctgatgtgcgcg
gtgatgaacgataagtgcgatatgcttaatctgttcctgcaatgcggtgcagatgtggcc
atcaagggtcccgatggcaagacgagtttacatattgccgcgaagttgggtagcgtggag
gccacgcagctgatcgtggagagctacaaggcctcgcggaacattaccaacttcctgagc
ttcatcgatgcgcaggacgagggcggctggacggccatggtatgggccgctgagctcgga
cacacggacattgttagcttgctgctgaaccagggggcggatcccaacctctgcgacaac
gacaacaacacggtactgcactggtccacgttgcataacaatggcttagacacgatcacg
gtgctgctgcaggcaggggccgactgtaatgttcagaatgtagagggcgatacaccgctc
cacatcgcctgccgtcattcggtgacccgaatgtgcatcgctctcatcgccaatggagcg
gatttgatggtgaagaacaaggccgagcagttgccctttgactgtatacccaacgaagaa
tcagagtgcggccgcaccgtcggcttcaacatgcagatgcgcagctttcggcccttgggt
ctgcgcacccttgtcgtgtgtgctgacgcttcaaacgggcgagaagcgcgccccattcag
gcggtgcgcaacgagctgacgatgtcggaaaacgaggatgaagcggacacgctgatgtgg
ccagacttccgctacattaccaactgcatcatccagcagaactcggtgcaaattgaccgt
cgcgtctcccagatgcgcatctgctcctgcctagatagctgcagcagcgatcagtgccag
tgcaatggagcctcctcacagaactggtacacggccgagagccggcttacgtccgacttc
aactacgaggatccggcggtgatcttcgagtgcaacgatgtttgcggatgcaaccagctc
tcgtgcaagaatcgcgtcgtccagaacggcaccaaaacgccgctgcagatcgtggagtgc
gaggacccagccaaaggctggggcgtacgtgccctggccaacgtccccaagggtactttc
gtggcatgctacacgggagagattctgaccgccccggaggcagatcgccgcaccgatgac
agctactacttcgacctagagcacgggcactgtatcgatgccaactactacggcaatgtg
actcgcttcttcaaccactcttgcgatcccaatgtgctggccgtgcgcgttttttacgag
caccaggattaccgctttcccaagatcgcctttttcgcctgccgcgacatcgatgccggc
gaagagatatgctacgactacggagaaaagttctggcgcacagaacatcgctccgcactt
ggctgcaagtgcttggcggactcgtgcaaatatgccaaccaatcccctagcataaatgca
tcgcccacagaggcgacgactgcagaagcagctgctgcggagtcggccgaaccggatacg
gtttaa

DBGET integrated database retrieval system