KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15644Help
Entry
Dpse_GA15644      CDS       T01032                                 

Definition
GA15644 gene product from transcript GA15644-RA
Orthology
K04437  
filamin
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dpse_GA15644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 2959 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNTDGSTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQVHDWATDFCDGTCLCALVEGLQTRPLKPSWNRRPANQHHYL
ENATTALKSIEADHIKLVNIGNVDIINGNVKLILGLIWSLIVRYQIGRSKFPPRKLMLAW
LQAALPDCKITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCTNAMNLAQRE
FGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDPVKNFTTDWN
DGRVMCEIIKGLGGSAPAPEKLSTDPFHYENNIRKAVDAGAKLGVQPILTAKDMATPEVE
HLGIMAYAANLQWVPPRPPLSDLVNVYLESTSGRVGEPTHFRIDVMSRDISLSSVRCHVV
PPSGQPGQTVRPNAHGEGVYVPERYGMHEIVVEIGEDSLGGHFFRVLPRQLQVAPPGMAP
CALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKPDEAGIWEIA
ITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGELHVDIVHDK
HSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKGRSGKTRSSP
LHESKHRSESPSMHFISTTNARHSDYRNASLSRHNTAERTNSYSPQYSPKLDTTDYHSSS
SRYYKRESEENHTSTPPPPPISGSPTVKYLNSADLYTESPTGGRRDSKTSNSSSIKNDYY
YDKENELYSQRRGAAKPKLTPPREERESQSSSSNSYQQRHQQLTSTVTSSLSPIPSPTLN
TRSSEMHTQSPLTIKTSNQFESSTRNLSGSPRHASVSPVQRYSPNSAYITTATHRMGSPV
TSTLNKNGYETTRTVEKSSSSTYKSSSNYVTDSNVRASPSLYGTAERLRRTGSPEPRIDH
SSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTETQLNTELQYNRPDLDHET
HRNTQYNKFALHKQQQQQQQQQSDYRRDSPDNAERYKPSAITVKSHSNNTYTDKSGGYTK
TVKESSEHVVTESNGHGPLPSPGYGYSSLSRFRPIDGNATGARAIRVQDIPNGSIGRPVE
FEIDGSKAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNGETVAGS
PWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPNKSKLNAR
VTHEAANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVNGGVVGQ
PCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIKFNGETV
RGCPFVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPLGELPVRV
TGDIHAGFTAEFTPTSVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRGTMGRPV
QFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVSFNKMPV
PGCPITVGISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGPAGQSVPAQV
HQSAEGVFKAEFVPRVVGEHRVNVTVNGLATAGSPYAAKVYDVSAIKVKNVSSGTVGKPV
TFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAESHTVELRFNSQDVPG
SPFTCRVAAAARIQSPETMDKVSVGRLFEFVVESDTKPTVEVLGPARRSVPVKIDPLGSS
ALGYNVKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEKVIVTDIRAGVVNKSVSFG
INASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTEAASHSLSVRFNGHPVPGS
PFSCHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEGFEGVEPQIFVTSPSGDNE
HCQMSQHDGGSYSASFRPSTVGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLEQQYG
PATLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACARGLYDVTFVPQSTEPHYVN
ITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVEIISPDQKSVPYTINRQTA
EFRTHVTGNYTLRFIDRETRQHIGSRTLCAFDPMLVKITEVGEAFCHRPASIGVSLNEAG
QGDLSALVRCGATEVPHTIRGPNKAGVYEIVYQPTRVAPHKISILFNDVPISLKPLEINV
LPASAGKEISVSGLGLYQARVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVRCYQTKN
GHLQAEFSINKPGQCLIEVLHQSKPLPGSPFTCESFDSSKVSIQGVTKESLALHSPNSFT
VRTDNAGTAELEAFAISPSNQSLPVLINEQSEGLYNVEFVPSQPGNYKLTLMYGGETIPS
SPLNFTASASGVRNDARAAGHGLEVCHRNKEASFVVYCPIAPNVQIERLDEYGERIEPKI
KALGNNEWRISYVILSVGKYEIRASCPNRGSLPGSPWHISCVESNKVTPVGGWGTLVDHD
GRLILPARIIFEVDNAGPGKLVCSIDGIEIPVDQMSDGKMCLNITGENLAAGEHDLDLTW
SGLTITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFTIDASNAPAGRPEVVLCTS
QDNTSLAVSLSQPRPSENIWLASYTPQKSTTGTLTLSVKWNGRLVKGCPLTVAVGSSMDA
SKVIASGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKVAYCELYDHGDATFTLNI
KPQEPGRHLLTIKYGGQNVPGSPFALKVAGAPDASKVRVYGPGIEHGVLATFQSRFICDT
RGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGEFVPGSP
FPVMIFDTEEELRRFLQGI
NT seq 8880 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaagacataaagggcgccaaggtgacgcatgcgggtcttctgaagcacaac
accgatggcagcaccgagacgcagaagatcacccacgcgggcctggtggcccgcagcccc
gagggcaccgccgccaagggcatgaacatacgcggcaacgaggatctctgggtggagatc
caggcgaacaccttccgcaactgggtcaacgagcatttgcgcgagacgggaatgcaggtc
catgactgggcaacggacttctgcgatggcacctgtctgtgcgccctcgtggagggcctg
cagacgcgtccgctgaagccctcctggaaccggcggccagccaaccaacatcactatctg
gagaacgccaccacggccctgaaatccatcgaggcggaccacatcaagctggtgaacatc
ggcaatgtggacatcatcaacgggaatgtcaagctgattctcggcctaatctggtcgctg
atcgtccgctaccagatcggacgcagcaagttcccgccccgcaagctgatgctggcctgg
ctccaagcagcactcccagactgcaagatcaccaacctgaccaccgactggaacagcggc
gttaatctggcggcactgctggactactgccagccgggcctgttcccacactggcgcagc
ctcgatcctagtcagagtgtgcgcaactgcaccaacgccatgaacctggcgcagcgcgag
ttcggagtgcccaaggtcctggaaccggaatacctggcctcgccatggctggacgagttg
tcgggcatgacgtacctctcgtacttcatgaagcccggcggtcctggctacaatgccacc
atgcgatgggtgaacacgcaggtcaaagatcctgtgaagaattttactaccgattggaat
gatggacgtgtcatgtgcgaaatcattaagggactgggcggctcggcgccagcgccggaa
aagctcagcacagatcccttccactacgagaacaacatacggaaggcggtggatgctggg
gccaaactgggcgtacagcccatactcacagccaaggacatggccaccccggaagtggag
catctgggcatcatggcctacgcggccaatctgcagtgggtgcccccacgtccgccgttg
tccgacctggtcaacgtttatttggagagtacttccggacgggtgggcgagccgacgcat
ttccgcatcgatgtaatgtcgcgggacatcagcctgagctcggtgcgctgccatgtggtg
ccgccttccggccagcccggtcagacggtgcgcccgaatgcccatggcgaaggagtctac
gtgccggaacggtacggcatgcacgaaatcgtggtggagattggcgaggacagcctgggg
ggccacttcttccgcgtcctgccccgccagctgcaggtggccccgcccggcatggccccc
tgtgccctgggcagcctcgtcgaagtgctggtcaatgccacgggagcgcccaaaacggag
gacatcctcgttacagccgtctcccccacgggcatctcccacaactgtccgctgaagaag
atcgacgagggacacagtgccatatttaagccggatgaggctggcatctgggagatagcc
atcacctaccagggcaggcacatccagggcggacccttcacctgcgcggtgttcgatgcc
tccggcgtttccgttcacggcctcgatggagccatgcccctgcgtgcccacaccttcgag
gtggatgcccgcggcgtgggcgtctccggcgaactgcacgtggacattgtccacgacaag
cattcgctggtgtgttccgtggagaagatcgtcgagaacaagtaccgagtgacctttatg
ccgcgccagaatggcaagtaccgcgtctacatctacttcaatggctacgatgtcaaggga
tcgcccttcatcatgcgcgtgggcaccaagggacgatcgggaaagacgcgcagcagcccg
ctgcacgagagcaagcaccgctcggagagtccatcgatgcatttcatctcgacgacgaat
gcacgccacagcgactaccgcaacgcttccttgtcgcgccacaatacggccgagcggacc
aacagctactcgccgcagtactcgcccaagctggacactaccgactaccacagctccagc
tccaggtactataaacgggagagcgaggagaaccacacatccacacctccgccccccccg
atcagcggttcaccgacggtgaagtacctgaactcagcggacctctacacggagagcccc
actggcgggcgtcgcgactcgaagacctccaacagcagctccatcaagaacgattactac
tacgacaaggagaacgagctgtacagccagcggcgcggggcggccaagcccaagctgacg
cctccgcgtgaagagcgcgagagccagagcagcagcagcaacagctaccagcagcgacac
cagcagctgaccagcacagtgaccagctcgcttagtccaatacctagtcccacactaaat
acacggtccagcgagatgcacacccaaagtccgctgaccatcaagacatcgaatcagttt
gagagctccacgcgcaacctcagcggcagcccccggcacgcctccgtttcgcctgtgcag
cgctactctccgaatagcgcctacatcacgacggccacacatcgcatgggcagtccggtg
accagcactttgaacaagaatggctatgagacaacgcgaaccgtggagaagtccagctcc
tcgacttacaagtcatcctcgaactacgtcacggactccaatgtgcgggcaagtccctcg
ctctatggcacagcggaaagactacgtcgcactggctccccggagccgcgcatcgatcac
tcctccaacgtgagggtgtcctccatgaagccggcatcggccaggcgcgacagctgggac
gtgatcaacaagacgaagcacatgctctctcacaattcgctcgaatcgctggcgaacatg
accgagacgcagctaaacactgaactccaatacaatcgcccagatctggaccacgagacg
caccggaacacgcagtacaacaaattcgccttacacaaacagcagcagcagcagcaacag
caacagtcggattaccgtcgtgactcgcccgacaatgcagagcgctataaacccagtgcc
atcacagtcaagtcacactcgaacaacacgtacacggacaagtctggcggctacacaaag
accgtcaaggagtccagcgaacatgtggtcaccgagagcaatggacatggtcccttgcct
tctcccggctatggctacagttcgttgtcgagatttcggcccatagacggcaatgcgact
ggtgctagggccatacgagtgcaggatataccaaatggctccattggccggcccgttgag
ttcgagatcgacggatcgaaggccggctctggcaacctggagattctggtcaacggcgga
cgtgtcacctcctcggtgcgctcgctgggcggacaaagattcattgccagtttcacaccg
cacgagcatggaacgcacactgtgcagatcaccttcaatggcgaaacggttgcaggttca
ccgtggcacgctgaaatcatgtcctcacccggcctaaccgctctgggcgaatccacacgc
cttgtgcccgccaatacgccggcggtttttgagatactgccgcctcctggacaaagcctg
agcaagggcgagtgcgtggcaacggttttgactcccaacaagtcaaagctgaacgccaga
gtcacccatgaggcggcaaatggtgctgcacgcatcgagttcgtccccacggaagtggga
acgcacgtcatcgatgcgtccatcaatggcacgaagatagctggtggccctctgatcgcc
aaggtctacgactccagtctgatccaagtgaccgaagtaaatggcggagtggtcggccag
ccgtgccagttccgcgtggacgcgagtgccgcgggcgagggacagctggagatatccatc
aatgagggtgaagtccccaatcatgtccaggtggtgggcggcggtcgatgcctggtctct
ttcacgccggagcaggccaagtcccacctgatagacatcaagttcaatggcgaaacggtg
cgcggctgtcccttcgtctgcgccgtggcggacacctctcgcgtcctgctcaatctctcc
aacctggagctcatccccgtcaaccggccctcctccttccacatcaccgtcagcggaggc
ggggccgccgagctggccgtcagcgtgcgcggtcccctcggggagttgcccgttcgtgtc
acgggagatatccatgccggatttacggccgaatttacgcccaccagcgtcggcgggcac
tcgataaatgtggagtacaatggcttcgccgtccagggcacacccttcctggccaagtcg
tacgacgccagcaaggtggtcgtgggcagcgtctcccgcggcacaatgggtcgacccgtg
cagtttactgtcgatgcgggcgatgccggtgagggcaacttggagataaccatttcggcc
aagggacagaacattcccacgcaggtgcatccgcagggcagtgcaagattctccgtttcg
tttgtgcccaccgagtcgtgcgagcatacgattaacgtgtccttcaacaaaatgcccgtc
cccgggtgccccataacggtcggcatcagcgggggcgtggccgggccccaagtgtcgctc
ggcggacccggacccgtgcatcagaccaattcttttgtaatcaatcacaatggcggccgt
ttggaagacattgaggtcaatgtggaaggacctgctggccagtcagttcctgcccaggta
catcagtccgctgagggcgtcttcaaggccgagtttgtgccccgcgtcgtgggcgagcat
cgcgtcaatgtcacggtcaatggattggccaccgccggtagtccctatgcagcgaaggtc
tacgatgtcagcgccatcaaggtgaagaatgtaagcagtggaacagtcggcaagcccgtc
accttcctggtggagacctcccaggcgggtcccggaaatttggaggtgactgtgaatggc
ggccgagtaccgacctcggctcaggcccaaggacagcacacctatgcaattagtttcacg
ccccgtgaggccgaaagccacaccgtggagctgcggttcaacagccaggatgtgcctggg
tctccgttcacctgccgcgtggccgccgcagctcgcatccaatccccagagacgatggac
aaggtgagcgttggaaggctcttcgaatttgtggtggaatcggacaccaagcccaccgtt
gaagtgctgggacccgcccgccgcagtgttccagtcaagatcgaccccttgggctcctcc
gccctgggctacaacgtgaagttcgagcccatggaagtgggcgatcattcggtggaggtt
cgcctgcccggcggtggccatgttgaaggaagccccttcctcttgaaggcatattctgcg
gaaaaggtgattgtcaccgacatccgagccggtgtggtcaacaagagcgtcagctttgga
atcaatgcctcccaggcgggagctggcaatctggagatcattgtggccgtcaatggcaag
aatgtgcccaactttgtccaatccgagggcaatgctcgcttcaaggtgaacttcaagcca
acggaggcggcttcccactcgctctcggtgcgcttcaatggccatcccgtgccgggatcg
cccttcagctgccatattgcagctgcggccgcttcgccatctatgggactaccgcgtgcc
atggctatgggagagtgcctcaagcaggcggccgtgaagatggacaataccttcgagctg
gaaggcttcgagggagtggagccacagatctttgtcacctctccatcgggtgacaacgaa
cattgccagatgagccagcacgatggtggcagctactccgcctccttccggcccagcact
gtgggtcgtcacctgatcagcgtgaccgcgaatgaccagcacatcaacggttcgcccttc
agctgcaatgtcttcgatgtttcgcgtgtcagcattagcggactggagcagcagtatggt
ccggccacactgggagttcctgtgacattcagtgtggatgcagccggagctggcgagggc
accttggagctggtagtctccaccgacagcagcacagtcaaggccgaggtggtggcttgt
gcccgaggcctgtacgacgtgacatttgtgccacagagtacggagccgcactacgtgaac
atcaccttcaacgaggtggccgtcgatggcagtcccttccgcgtggacatccagcagcac
acgcagcacatacagattggcagcctggccgctattgacttcccggccgatgatcagatc
gtggagatcatatcccccgatcagaagtccgtgccgtacacaatcaatcgacagacggca
gagttccgcacccatgtgactggaaactacacgctgcgcttcatcgatcgggagacgcgc
cagcacattggatcgcgcaccctctgcgccttcgatccaatgctcgtcaagatcacagag
gtgggggaggcattctgccatcgcccggccagcattggcgtctccctgaacgaggccggt
caaggggacctttctgcccttgtccgttgcggagcgaccgaggtgccacacaccatccgc
ggacccaacaaggccggcgtctatgagatcgtctatcagccaacccgtgtggcgccccac
aagatcagcatcctattcaacgacgttcccatctcgctgaagcccctggagatcaacgtg
ctgccggccagtgccgggaaggagatcagcgtcagcggtttgggtctttaccaggcgaga
gtgggcaagaccacgtcctttgctattgataccgtgaagaggccggcgagggagtttgat
gtggtggtgtcgggcccaggaggacaggcgctgcccgtccgctgctaccagaccaagaac
ggacatcttcaggcggaattcagcatcaacaagccgggccaatgcctgattgaggtactt
catcaatcaaagccgctgccaggcagtcccttcacctgtgagtccttcgacagcagcaag
gtcagcatccaaggcgtcaccaaggaatcactagcactgcacagccccaacagcttcacc
gtgcgcacggacaatgccggaacagccgagctggaggcgttcgccatctcgcccagcaac
cagagcctgcccgtgctcattaacgagcagtcggaaggcctctacaacgtggagtttgtg
ccctcccagccgggaaactacaagctcacgctgatgtacggcggagagacgattcccagc
tcgcccctgaacttcaccgcctcggccagtggcgtgaggaacgatgccagggcagctggt
catgggttggaggtgtgtcatcggaacaaggaggcttcgtttgtggtctactgtcccatt
gctccgaatgtgcagatcgaacgactggacgagtatggagaacgcattgagccaaagatc
aaggctctgggcaataacgagtggcgcatctcctacgtaatcctctcggtcggcaaatac
gagatccgagccagctgtcccaatcgaggcagcctgcccggctcgccctggcacatctcc
tgcgtggagtccaacaaggtcacgccagtgggtggctggggcacgctggttgaccatgac
ggacggttgattctacccgcccgcatcattttcgaggtggataatgcgggacctggcaag
ctggtctgtagcattgatggtatcgagatacccgtggaccagatgtctgatggaaagatg
tgccttaacatcactggagagaatctggctgcgggagagcacgatttggacctgacctgg
agcggactgaccatcacccaatgtccgagaagcgcctttgtcacaggacaacaagctgcg
gataaggttcagctgatgggccgtggtctggcagcggcacaggcgggcgaggcggctcac
ttcactatcgatgcctcgaatgcgccggctggcagaccagaggtagtcctatgcaccagc
caggacaacacatcgctggccgtcagcctgtcgcaaccccgtcccagcgaaaacatatgg
ctggcctcgtacacgccgcagaagtccaccacgggcacacttacactgtccgttaagtgg
aacggccgattggtcaagggctgtccgctcacagtggctgtgggctcctccatggatgcc
tccaaggtgattgcttccggcgagggcctgcgacacggtattgtaggcaaggatatcaag
tcgtggattgacaccaggcgagcaggtcctggcgaactaaccgcccactgtgccggtgtc
cgcaaggtggcctactgcgagctctacgaccacggagatgccacattcaccctaaacatc
aagccgcaggagccgggtcgtcatctgctgaccatcaagtatggcgggcaaaatgtgccc
ggctctcccttcgctttaaaagtggccggagcaccagacgccagcaaggttcgcgtttat
ggcccgggcatagagcacggtgtactggccaccttccagtcccgtttcatctgcgacaca
cgtggcgccggagcaggacagctgacagttcgcgtacgcggtcccaagggcgccttccgc
gtggaaatgcagcgcgagagccaaaaagatcgcaccatcctgtgcaagtacgatccaacc
gagcccggcgactatcgcgtcgaggtcaagtgggcgggcgagttcgttccgggatcgccc
ttccccgtcatgatcttcgacactgaggaggagttacgaaggttcttgcagggcatatga

DBGET integrated database retrieval system