KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15730Help
Entry
Dpse_GA15730      CDS       T01032                                 

Definition
GA15730 gene product from transcript GA15730-RA (EC:2.3.1.-)
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA15730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1182 aa AA seqDB search
MSEEEVEHSREEEFSRNEERPHEEEQLRGKKGSRDEENSRDQDYSRDEERSFEEERSRDE
DHETSREEAQEHLRVDHQEHPREEEQELSREEENSHEEEHSREEENSHEEENSHEEEHSH
EEEHSHEEEHSHEEEHSHEEEHSHEEEHSREEEHSREEENSHEEEHSLVEEHSHHKQNLP
HEELSRDEEPSTNQEHSRNEENSGDEGLLRDEEQSCYEEHLPVEVEETSRDEEHLGGQEH
SQTDVHSRDEEHQLDEAHTRYDEHPRGDWVQYEESSPYEVAPYEDPPRPPQYEEQSRYLD
VTTDCYMVEVDSEEKSTAAHEEADMNAMEIVDQPASEGAEPDQSIDMSCVNTALEADEDG
EPPAKREKPHYENSPVTEDSSSSSSTSSGSDSSSHSDDYDDSTKDDASVDTVIYVEDLPP
TISYPRMDPDAPTKPIITEVVTIPAPRVNLLRYPMPNIQHHMPPPPPRRPVDSEPELDPD
DYDGAVAMPGLPAKDCGDNINLPPYIPDHYISPRAEQQPEQESTRHQFIYPRQPLDYQSQ
QRAGVQSAQDNQQFVYPRQPLDYPAQQRTQLPLDQQFVYPRQPLAFPPQAQSEQDKDKYP
PPRVPARQLIDSYKIKHRPPSGDRRRMPPPGPMRTVLGAEMENISDDDEISDAEESSSSD
GSSSENESEDEDDDYILIENDSNSAGTETETEIMAGSGDLGDGIVVNEDSEKVYYIRRED
GTVHAGRVLQSRITANVLMPNEYYVHYVGLNRRLDEWVGRHRISDNADDLGGITETASSL
LQLDSDQPGTSREMLQQQALLAQQQQILLQQQQQQRELEKERALREGNKDYYLSACENTR
YDYSDRKMTRYQKRRYDEINHVQKSHAELTASQAALEKEHESITKIKYIDKLQFGNYEID
TWYFSPFPGDYGKARTLYVCEYCLKYMRMRKSYSYHTYVCRKRHPPGREIYRKGNISIFE
VNGKEEPLYCQLLCLMAKLFLDHKVLYFDMDPFFFYILCEVDREGSHIVGYFSKEKKSPD
NNNVACILVLPPHQRKGFGKLLIAFSYELSRREGVIGSPEKPLSDLGRLSYRSYWAYTLL
ELMRNRVSLEQTTIKELSEVSGITHDDIIYTLQSMKMIKYWKGQNVICVTTKTIFDHLLL
PQFKKPKLTIDRSYLFWNPTNMPAPARPPLPINATALGQIAV
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggaggaggtggaacattcgcgcgaggaagagttctcgcgcaacgaagaacgc
ccccacgaagaggaacaattgcgcggaaaaaaaggatcgcgcgacgaggaaaactcacgc
gaccaagactactcacgcgacgaggagcgctccttcgaggaggagaggtcgcgtgacgag
gaccacgaaacctcgcgcgaggaggcgcaggagcacttgcgcgtggatcaccaggagcac
ccacgggaggaggagcaggaactctcccgcgaggaggagaactcgcacgaggaagaacac
tcccgagaggaggagaactcgcacgaggaggagaattcgcacgaggaggagcactcgcac
gaggaggagcactcgcacgaggaggagcactcgcatgaggaggaacactcgcacgaggag
gaacactcgcacgaggaggaacactcccgcgaggaggaacactcccgcgaggaggagaac
tcgcacgaagaggagcactcgcttgttgaggaacactcccaccataagcaaaacttgccc
cacgaggaactttcgcgagacgaggaaccctcaacgaaccaagagcactcgcgcaacgag
gaaaactccggtgacgaagggctcttgcgcgacgaagagcagtcgtgctacgaggaacac
ttgcccgttgaggttgaggagacctcgcgcgacgaggaacacttggggggccaggaacac
tcgcagacggacgtgcactcacgcgacgaggaacaccagctagacgaggcacacacgcgc
tacgatgaacatccgcgtggcgattgggttcaatacgaagaatcttcgccctacgaggta
gcaccatacgaggatcccccgcgccccccgcaatacgaggaacaatcgcggtatttggat
gtcacgaccgactgctatatggttgaagtcgattctgaagaaaaaagtacggcggctcac
gaggaagccgatatgaatgccatggagattgttgatcagccagcctcggagggcgcggag
ccggatcagtccattgacatgagttgtgtcaataccgcactggaagccgacgaggatgga
gagccgccagctaagcgggaaaagccccactacgagaacagccccgtgacggaggacagc
agtagcagcagctcgacctcgtccggtagcgacagcagctcgcactctgatgattacgac
gattcaaccaaagacgatgcttccgtggacactgtcatctatgtggaggatctgccccca
accattagctaccctaggatggatcctgacgctccgaccaaaccaattatcaccgaggtg
gtgactattcccgccccgcgggtgaatcttttgcgttatccaatgccgaatatccagcac
catatgcccccgcctccgcctcggcggccggtcgattccgagcccgagcttgatcccgat
gactatgatggagcggtggcaatgcccggcctgccagccaaggattgcggtgataatatt
aatctccctccttatatcccagatcactatatatccccgcgcgccgagcagcagccggag
caggagagtacacgccaccagtttatatatccgcgccagccgcttgactaccagtcccag
cagcgcgccggcgtccaatcggcgcaggataaccagcagttcgtctatcctcgccagccg
cttgactatccagcacaacagcgcacccagctgccgctggatcagcagtttgtgtacccg
cgccagccgcttgcatttccgccccaggcgcagtcggagcaggacaaggataagtatccg
cccccgagggtaccggcgcgtcagctgattgattcctataaaattaaacacagaccaccg
tcgggcgatcgacggcgtatgccaccgccagggcccatgcgcactgtgctcggtgcggaa
atggagaacatttcggacgatgatgagataagcgacgctgaggagagtagcagcagcgac
ggcagcagcagcgagaacgaatctgaggacgaggatgatgactacatcctgattgagaat
gacagcaactcggctgggacggagacggagacagagataatggccgggtcgggtgatcta
ggcgatgggatcgtggtcaacgaggattccgagaaggtgtactacattcggcgcgaagac
ggcaccgtccatgccggccgtgtgctccagtcgcgcatcaccgcgaacgtcctgatgccc
aacgagtactacgtgcactatgtgggcctcaatcgccgcctggacgagtgggttggtcgc
caccgcatctcggacaacgccgatgacttgggaggcatcacagaaaccgccagcagcctc
ctccaattggacagcgatcagccgggaaccagtagagagatgctgcagcagcaggcgctt
ctggcgcagcaacaacagattttattgcagcagcaacagcaacagcgcgagctggaaaag
gaacgggccctgcgcgagggcaacaaggactactatctgtcggcgtgcgagaatactcgc
tacgattacagtgaccggaagatgacgcgctaccagaagcggcgttacgacgagatcaac
cacgtgcagaagagccatgcggagctgaccgcctcgcaggcggccctcgagaaggagcac
gagtccatcacgaagatcaagtacatcgacaagcttcagttcggcaactacgagatcgac
acctggtacttcagcccctttcccggcgactacggcaaggcgcgcacgctgtacgtgtgc
gagtactgcctgaagtatatgcggatgcggaagagctacagctaccatacgtacgtgtgc
cgcaagcggcatccgccgggtcgcgagatctaccgcaagggcaacatctccatttttgag
gtgaacggcaaggaggagcccctctactgtcagctgctctgcctgatggccaagctcttt
ctcgaccacaaggtgctgtactttgatatggatccgttcttcttctacattctgtgcgag
gtggacagggaaggcagccatattgttggctatttctccaaggagaaaaaatccccagac
aacaacaacgtggcatgcattttagtcctgccgccgcatcagcgcaaaggcttcggcaag
ctgttgatcgccttcagctacgagctgtcccgcagggagggcgtcattggaagtccagag
aagccgctgtcggacctcggtcgactcagttaccgcagctactgggcctatacgctattg
gagctgatgcggaaccgcgtttcgctggagcagaccaccatcaaggagctgagtgaggtg
agcggcattacccacgacgacatcatctacacgctgcagtccatgaagatgatcaaatat
tggaagggccagaacgtcatctgtgtcacgaccaagacgatcttcgaccacctactgctg
ccgcagttcaagaagcccaagctgaccatcgatcgcagctatctgttctggaaccccacc
aacatgccggcgccagcccgacctcccctgccaatcaatgccacagcacttggtcagatt
gcggtctaa

DBGET integrated database retrieval system