KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15834Help
Entry
Dpse_GA15834      CDS       T01032                                 

Definition
GA15834 gene product from transcript GA15834-RA (EC:3.1.2.15)
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA15834
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA15834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 1290 aa AA seqDB search
MGTTKEQQNEGDAAAEAAVGATHTTPTQHQRKETEEEEEKTLPTPPVVASTMATNAAKKI
RRAFSMPRNPFRWSRKFKTAAAAAAIASDAESGAGKDNAGERRGSHTAISSCVSGGRGRS
GSIISLSSYEAAPGDAAATTTTNTYANSNSNHTNNSTSNSNKRARVLRRSSFKKFLNRIA
QHLSATVNVGSEEQSSAAASRVNLIDIVPFYTGCWRRKEANKHRQTNGLGSASSGGGGDR
VPPIGGYQWPPDQTPGVMGLKNHGNTCFMNAVLQCLSHTDILAEYFVLDQYKADLKRRNK
INSRKFGTKGELTEQLANVLKALWTCRNESDHSTGFKAVVDRYGTQFRSSTQHDAQEFLF
WLLDKVHEDLNTASKRRYKSIKNSYGRSDEIIAAETLANHIRCNNSFVQAVFQAQFRSSL
TCPRCKKQSNTFDPFHCISVQLPQLTQQTIFVTVVYMKQQPRQIKMGLRVPAGSPIVALR
EQLQTDTGIAGSRMVLVDLNAEGFTRVFYDTQPVETLSSIESIYCIEVPEAQAKIGATTK
VAPSPSAPEAAEKIASAPAPAAAPQADLLLLVANVYRAKDGKDMTRFGAPFSMKAPRDCS
YQDLQKRMLREMSPLLKPEVFSYTTPLADMFRIRLQDPSADPDTYLEQVEHPLLTEMIDM
ALSVLASEAGPPHIKLLLEWNSPEDHFLARQQETDDEAVVEHESVARLSASKAKDTAALT
LEQCLEHYTKAETLSAEDAWRCPHCQQYLPVVKTLGLWSLPDILVVHFKRFRQHQSKGPQ
AAKLTTMVKFPLTAFDMSPHLAKGVHESATSSSLGILDGGGRGSNLWKRARSGDSRSSTL
NSRCDPKDTRYDLYAVCYHQGDTLETGHYTAACKNPYDRQWYKFDDQRVSKVPEDDIEQD
IINNEAYMLFYQRRSVDAGECSGSSSNSGDHWVSRIAPAPASATSSSADSTSGKENDGAI
KAEAGSSEVAESGPAAEKALSKPVNIPLVNEEAVAPEEPKVAANELPALPLNIEELDFAD
ADADVSLNEDAKNEGIEDPAEQIQANPAAAAAPKAAAAIEEVTHIFAMDEEQKEEPVEVT
KVISRSEILPESLPTAEVVRTNGHLSPSSSSASSESSLSSRSSPRSLTTSVAAASTLQNK
LNGHMNTACSSMFNGNGNANATHPQLSSSLQLTRQVLSNHNWHGSRSSVSAVENATQQQK
QQAAAAASLSLRHSFSTSSNYKLRECTETLSSLLRNSTNTCSKDTLLFIDQQSHHHTAGL
IEDDDDSYMGRSLWISPVTPHKLITVSPKN
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgggcacaactaaagagcaacaaaatgaaggcgacgccgcagcagaggcggccgtgggc
gccacccacacaacaccaacgcaacatcagaggaaggagacagaagaagaagaagagaag
acgcttcccacaccgccagtggtagcctcaaccatggccacaaatgccgccaaaaagata
cgccgagccttctccatgccacgcaatccgtttcgctggtcgcgtaaattcaagacagca
gccgcagcggcagcaatagcaagcgacgcagagtctggagccggcaaggataatgcaggg
gagcgtcgaggcagccatacggctatttcgtcctgcgtaagcggcggacggggacgcagc
ggcagcattatttctctgagcagctacgaggcggcgcctggagacgccgcagccaccacc
accaccaatacatatgccaatagtaacagcaaccacaccaataacagtaccagtaacagc
aataagcgggcacgtgttctgcgccgttcgtccttcaagaaatttctgaatcgcattgct
cagcatctgagcgcaacggtgaatgttggatcggaggagcagagctctgctgccgccagt
cgggtaaacttgatagacatcgttcccttctacaccggatgctggcggagaaaagaggcg
aataaacaccggcaaacgaatggtttgggatcggcgagcagcggcggaggaggagatcga
gtgcctcccattgggggctatcagtggccgccggatcagacgcccggagtgatggggctg
aagaatcatggcaacacctgcttcatgaacgccgtgctgcagtgcctcagccacacggac
attctagccgagtatttcgttttggaccagtacaaggctgaccttaagcgccgcaataag
atcaattcgcgaaagttcggcaccaagggagagctcaccgagcagctggccaatgtgcta
aaggccctatggacatgccgcaacgagagcgaccacagcacgggcttcaaggcggtggtg
gatcggtacgggacgcagtttcgcagctccacgcagcacgatgcacaggagttccttttc
tggctgctggacaaggtgcacgaggacctgaatacggccagtaagcgacgctacaaaagc
atcaagaactcctatggccggtcggatgagatcattgccgccgagacactggcgaatcac
atacggtgcaacaatagctttgtgcaggccgtgttccaggcccagttccgatcctcgctg
acgtgtccgcgctgtaagaagcagtcaaacaccttcgatcccttccactgcatttccgtg
cagctgccgcagctcacacagcagacgatcttcgttacggtggtgtacatgaagcagcag
ccgcgacagatcaaaatggggctgagagtgccggccggatcgccgattgtggccctgcgg
gagcagctgcagacggacacgggcattgcggggtcgcgcatggtgctggtggacctcaat
gccgagggattcacgcgcgtcttctacgacactcagcccgtggagacgctcagcagcatc
gagagcatctactgcatcgaggtgccggaagcccaggcaaagatcggcgccaccacaaag
gtcgctccctccccatcggctcccgaagcggcagaaaagatcgcctctgccccagcacct
gcggccgccccacaggcagatctgctcctcctagtggccaacgtgtacagagcaaaggac
gggaaagacatgacccgcttcggagccccgtttagtatgaaagctccgcgcgactgctcc
taccaggatctacagaagcggatgctgcgcgagatgtcgccgctgctcaagccggaggtc
ttctcctacacaacgcccctggcggacatgttccgcatccggctgcaggacccctccgcc
gaccccgacacctacctggaacaggtggagcatccgctgctcaccgaaatgatcgacatg
gccctctcagtgctcgcctcggaggcggggccaccgcacatcaagcttctgctggaatgg
aactcgcccgaggatcactttctcgcccgccagcaggagaccgacgatgaggccgtcgtt
gagcacgagagcgtggcacggctaagcgccagcaaggccaaagataccgccgccctaacg
ctggagcagtgcctggagcactacaccaaggcggagacgctcagcgctgaggacgcctgg
cgctgtccccactgccagcagtatctgcccgtggtgaagaccctgggcctttggtcactg
cccgacatcctggtggtccacttcaagcgcttccgccagcaccagtcgaagggtccgcag
gcggcaaagctcaccacgatggtcaagtttccgctgaccgccttcgacatgtccccccac
cttgccaagggtgtccacgagagcgccaccagcagctccctgggaatcctagatggcggc
ggtcgcggctcaaatctgtggaagcgggcccggtccggcgactcgcgctcttccaccctc
aactctcgctgcgaccccaaggacacgcggtacgatctgtacgccgtttgctaccaccag
ggcgatactttggagacgggccactatacggcagcctgcaagaacccatacgaccggcag
tggtacaagttcgatgaccagcgcgtgagcaaggtgcccgaagatgatatcgaacaggac
atcatcaataacgaggcgtatatgcttttctaccagcgacgcagcgtagatgccggagag
tgctccggctccagttctaactccggggatcactgggtctcccgcattgctccagcccca
gcttcggcaacctcttcatcggccgactcaacatctggcaaggagaacgacggagctatt
aaggcggaggcgggctccagtgaagtggccgaaagtggaccagccgcggagaaggccctg
tccaagcccgtgaatattccactcgtgaatgaagaagctgtggccccagaagaacccaaa
gtcgccgccaacgaactcccagccctcccactcaacattgaggagctggacttcgccgat
gccgatgcggatgtcagtttgaatgaagatgccaaaaatgaggggatagaagatccagca
gagcaaatccaagcaaatccagcagcagctgcagcacccaaagctgcagcggctattgag
gaagtcacgcacatttttgccatggacgaggagcagaaagaagaacccgtggaagtgaca
aaggtcatcagcaggagcgaaatactacccgagagtctgcccaccgctgaagtggttcgg
accaatggccatttgagcccctcctctagctcggcttcgtcggagagctcgctctcgtcg
cgttcctcgccacgttcgcttaccacctccgtggcagcggcatccacgctgcaaaacaaa
ctcaatggccacatgaataccgcatgctcgagcatgttcaatgggaatgggaatgcgaat
gccacacacccgcagctatcctctagcctgcagcttacgcggcaggtgctgagcaaccac
aactggcatggatcccggagcagtgtctcggctgtggagaatgccacacagcagcaaaag
cagcaggcggcggcggcagctagcctcagtctgcggcactccttctccaccagctccaac
tacaagctgcgcgagtgcaccgagacgctgtcctcgctgctgcgcaactcaaccaacacc
tgcagcaaggacacattgctgtttattgatcagcagagccatcaccacacagcgggcctc
atcgaggacgacgatgattcgtatatgggacggtccttgtggatatccccagtgacgcca
cacaaacttattactgtttcgcccaagaattaa

DBGET integrated database retrieval system