KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15892Help
Entry
Dpse_GA15892      CDS       T01032                                 

Definition
GA15892 gene product from transcript GA15892-RA (EC:2.7.11.-)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dpse_GA15892
   04150 mTOR signaling pathway
    Dpse_GA15892
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    Dpse_GA15892
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Dpse_GA15892
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   Dpse_GA15892
Mitochondrial biogenesis [BR:dpo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Dpse_GA15892
  Mitophagy factors
   Other mitophagy factors
    Dpse_GA15892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 587 aa AA seqDB search
MPQTRAAAAEAAAAGTVNGQPLVKIGHYLLGATLGTGTFGKVKIGEHQITRVKVAVKILN
RQKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKH
GKLQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDGE
FLRTSCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKS
GIFPIPEYLNKQVVNLVCQMLQVDPLKRANIEEIKKHEWFQKELPAYLFPSSIEQDSNVI
DTYAVAEVCTKFGVKELEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFF
VAGSPPPLPIATHASHETPGQASGQTPLATVTVGGGTAASSGSATPVPPGVAPPSSSVLA
AIRPHPERIAPMRDRQLAMSVQNSGGAAFPEKTARGGTPIKRAKWHLGIRSQSKPNDIML
EVYRAMKALNYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNEEV
EQGDDVIMESLTPPPLSVTGLMPLQPTGHHTMEFFEMCAALIIQLAR
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgccccagacgagggctgcggccgctgaggcagcggcggcgggcaccgtcaatggccag
ccgctagtgaaaatcggccattatctgttgggcgccacgctcggtacgggcacctttggc
aaggtaaagatcggtgagcatcagattacgcgcgtcaaggtcgccgtcaagattcttaac
aggcagaagatcaagagcctagatgtggtgggtaagattcggcgagagatccagaatctg
aagctcttccggcatccgcacatcattaagctttatcaggtgatctccaccccatcggac
atcttcatgatcatggagtacgtgagcggcggcgaactgttcgactacatcgtgaaacac
ggcaagctgcaggagcatcaggcgcgccgcttcttccagcagatcatctcgggcgtggat
tactgtcatcggcacatgattgtgcaccgcgacctgaagccggagaacctcctgctcgac
cacaacatgcacgtgaagatcgctgactttgggctatcgaacatgatgctggacggagag
ttcctgcgcacctcgtgcggctctcccaactatgcggcgcccgaggtcatttcgggcaag
ttgtatgccggtcccgaggtggacatctggtcgtgcggcgtcattctttacgccctgctc
tgcggcacgctgcccttcgacgacgagcacgtgccgacgctcttccgaaagatcaaatcg
ggcatcttccccataccggagtacctcaacaagcaggtggtcaatctggtgtgccagatg
ctgcaggtggatcccctcaagcgggctaacatcgaggagatcaagaagcacgagtggttc
caaaaggagctgcccgcctacctcttcccctcgtcgattgagcaagactcgaatgtcatt
gacacctatgccgtggccgaggtctgcaccaagttcggggtcaaggagctcgaggtgcac
aactcgctgctcagcggcgatccacacgaccagctggccatcgcgtaccacctgatcatc
gacaacaagcgcttcgctgacgacgccgccaaccagatcaacgagatcaataacttcttt
gtggccgggtccccgccgccgctgccaatcgccacccatgcatcgcacgagaccccagga
caagcctccggccagacgcctctggccacggtaactgtgggcggcggaacggccgccagt
tcgggcagcgccacgcctgtgccacccggagtggcgccgccgagcagcagcgtgctggcc
gccatacgaccgcatccggagagaatcgcaccgatgcgcgaccgccagctggccatgtcc
gtgcagaactcgggcggcgctgccttccccgagaagacggcacgcggcggtacacccatc
aagcgggccaagtggcatttgggcatacgatcgcagagcaagcccaacgacataatgctg
gaggtgtaccgggccatgaaggcgctcaactacgagtggaagatcatcaatccgtaccat
gtccgtgtgaggcggcagaacgtgaagacgggcaagttctcgaagatgtcgctgcagctg
taccaagtggacgccaagagctatctgctcgacttcaagtccctcaccaatgaagaggtg
gagcaaggggacgacgtcatcatggagagcctcacaccgccaccgcttagcgtgaccggg
ttgatgccgctccagccgaccggccaccataccatggaattcttcgagatgtgcgcggcg
ctcattatacagctggcgcgctga

DBGET integrated database retrieval system