KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA15904Help
Entry
Dpse_GA15904      CDS       T01032                                 

Definition
GA15904 gene product from transcript GA15904-RA (EC:2.7.11.-)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dpse_GA15904
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Dpse_GA15904
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dpse_GA15904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 416 aa AA seqDB search
MSHQSNNVLRPKANAMARKPEAVTALGMQKKNLLLTKKSTSENMAPGCKLLPSSVSAKTA
TTIARPVQDAMSKFAKPLVPTASTLKKPTSEFVAPAPVTEPKKTNADPVDKPLATATATE
AARSAESTASSSSNSTDKEKGKTENQPPKPKKTWELNNFDIGRLLGRGKFGNVYLAREKE
SQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAP
QGTLFNALQAQPSKRFDERQSATYIKSLCSALLYLHERDIIHRDIKPENLLLGHKGVLKI
ADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSK
NYDETYKKILKVEYKLPEHISKAAAHLISKLLVLTPQHRLPLDQVLVHPWILAHTK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcagtccaacaatgtgttgcgtccaaaagcaaatgccatggccagaaagccg
gaggcagtcactgcacttggcatgcagaagaaaaatttgctgctgacaaaaaagtcgaca
agcgagaatatggcaccaggctgcaagcttcttccgtcttccgtatcagccaaaacggct
acgacaattgcgcgtccagtccaagatgcaatgtcgaaatttgcgaagccacttgtaccc
actgccagtacactaaagaaaccaacctcggagtttgtggcgccagctcctgtgactgaa
cccaagaagactaacgctgaccctgtggataaaccattagccacagctacagcaacagaa
gccgctcgatctgctgaatcgactgcatccagctcttcaaacagcactgacaaagagaaa
ggcaagactgaaaatcagcccccaaagccaaagaaaacttgggagctgaataacttcgac
attggccgtctactgggacgcggaaagttcggcaatgtgtacctggcacgcgagaaggag
tcccagttcgtagtggctttaaaagtcctgttcaagcgtcagattggcgaatccaatgtg
gagcatcaggtgcgccgggagatcgaaatacaatctcatctgcggcacccgcacattctt
cgcttatacgcatactttcacgacgatgtgcgcatctacttgatcctggagtatgcacca
cagggtactctcttcaatgcgctgcaggctcagccgtcaaagcgcttcgatgaacgccag
tcggccacctacatcaagtcgctctgctcggccctcttgtatctgcacgagcgtgacata
atccatcgcgatatcaagccggagaatctcctgctgggccacaagggtgtgctgaagata
gccgattttgggtggtcagttcacgaacccaattccatgcgcatgacgttgtgcggcact
gtggactatctgccaccggaaatggtgcagggaaagccgcacacaaagaacgtggacctg
tggagcctgggtgtgctctgcttcgaactgctggtgggtcatgccccattctattcgaaa
aactatgacgagacctacaagaagatcctcaaagtggagtacaaactgccagagcatatt
tccaaggcggctgctcacttgatttccaagctgttggtcctcactcctcagcatcgtctg
cccctggaccaggtgttggtacacccgtggattctggcacatacaaagtga

DBGET integrated database retrieval system