KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA16046Help
Entry
Dpse_GA16046      CDS       T01032                                 

Definition
GA16046 gene product from transcript GA16046-RA (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dpse_GA16046
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dpse_GA16046
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA16046
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dpse_GA16046
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 559 aa AA seqDB search
MSASKGVLLLAVLLLIAAIGGRGETVPCKVKDAEQGKVCVCTADYCDYLENPTLTDDTEF
ALISSSKQGLRFATSHGHFGTEDTYTVQDYVEPVPEAKNKTIFSRLLDQALVSAFTLDSR
ESTITRFVTLKVNRSKTYQTMTGFGGSYTGAVSYLVDNFKQPELADHLYKSFYAEEGLGF
NLMRISIGGCDFDLGAWAYAEEEDNTMLDDMDELDERDVMRVGHIKRLVEVSGIKNLRIK
GAAWSAPPWMKTNNRWTGFGRLKKQYYQTWADYHLKWVKLMEDNGLPIWAISTGNEPLNG
IFFMYFVKFMSMGWTPQTQAIWLNDHLGPTIRNSEFKDIILFGNDDQRYSFPHWFKMMNY
TRPNSVDYLDGLSLHWYWDEIFGSSLIDETTEYAPDKLLIVSESCIGDKPWQRSAPVLGS
WERAEKYTRAFLENIKHGFHAWIDWNIILDEEGGPNYVDNTVDAPVIANTTTNEEFYKQP
MFYAMGHFSKLVPEGSIRVDAVPSNVNLDCVAFLRPDKKIAAVLFNSGRADTNITVVDSE
RGQFTVNVPAKSIHTLLYS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagcaaaggagttttgctgctcgccgtgctgctgctgatagctgcaatcggt
ggccggggggaaacggtgccgtgcaaagtgaaggatgcggagcagggaaaggtgtgcgtg
tgcacggctgattattgcgactacttggagaatcccacgctgacggacgacacagaattc
gcactgatttccagctccaagcagggtctgcgattcgccacatcccacggacacttcggg
acagaggacacgtacactgtgcaggactatgtggagcccgttccagaggccaaaaacaag
acaattttctcccgcttgctggatcaggctttggtcagtgccttcaccttggattcgcgc
gagagcaccatcacccgcttcgtgacactgaaagtgaatcgcagcaaaacctaccagaca
atgacgggcttcggtggcagctacaccggagccgtatcctacctagtcgacaatttcaag
cagcctgaactcgccgaccatctgtacaagtccttctacgctgaagaggggctgggcttc
aatctgatgcgcatatcgatcggcggctgcgactttgacctcggtgcctgggcctatgcc
gaggaagaggacaacacaatgctcgacgacatggacgagctggatgaacgtgatgtgatg
cgtgtgggccacataaaacgcctcgtcgaggtctcgggcataaagaatctgcgaattaag
ggtgcggcctggagtgctccgccttggatgaagacgaacaacaggtggacaggattcgga
cgtctcaagaagcagtactaccagacctgggccgactaccacctcaagtgggtgaaactg
atggaggataatggactgcccatctgggccatttccacaggcaacgagccactgaacggc
atcttcttcatgtactttgtcaaattcatgagcatgggctggactccacagacgcaggcc
atctggttgaacgaccatctggggccaacgatccgaaactctgagttcaaggatatcatc
cttttcggcaacgatgatcagcgctactcctttccacactggttcaaaatgatgaattac
acacgccccaattcggttgattacctggacggattatcgctgcactggtattgggatgag
attttcggtagcagtcttatcgatgagaccaccgagtacgcgcccgacaagctcctaatc
gtctccgagtcgtgcatcggcgataagccctggcagaggtcggcccccgtcctgggcagc
tgggagcgggctgagaagtacacgcgcgccttcttggagaacataaaacatggcttccat
gcctggatcgattggaatatcattttggacgaggagggcggccccaactatgtggacaat
acagtcgatgcccccgtcattgccaacaccacaaccaatgaggagttctacaagcagccc
atgttctatgccatgggtcacttctccaagctggtgccagagggctccatacgcgtcgat
gctgtgcccagcaacgtcaatctggattgcgttgccttcttgcggccggacaagaagatt
gccgccgtgctcttcaacagcggacgcgccgatacaaacattactgtggtggacagtgag
cgcggccagtttacggtcaatgtgcccgccaagtccattcacaccttgctgtacagctga

DBGET integrated database retrieval system