KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA16177Help
Entry
Dpse_GA16177      CDS       T01032                                 

Definition
(RefSeq) GA16177 gene product from transcript GA16177-RB (EC:3.2.1.23)
  KO
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dpse_GA16177
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dpse_GA16177
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dpse_GA16177
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dpse_GA16177
   00511 Other glycan degradation
    Dpse_GA16177
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA16177
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dpse_GA16177
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA16177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 654 aa AA seqDB search
MYLSSFNLHSLWSKMKLGLMIVASLWGVVSLMGAAHGNRTFTVDYANDQFLKDGVSFRFI
AGSFHYFRAHPATWQRHLRTMRAAGLNAVTTYVEWSMHNPRDGTYVWTGIANLEHFIRLA
VAEDLLVILRPGPYICAERDMGGFPYWLLKKYPNIQLRTADVNYLSEVRIWYNQLFTRMV
PYLYANGGPIIMVQVENEYGSYFACDSKYRTWLRDETESHVKGHAVLFTNDGPSVLRCGK
IENVLATLDFGATNDLDATWARLRQYQPNGPLVNAEYYPGWLTHWTEPMANVSTNSITGT
FINMLDQGASVNFYMFYGGTNFGFTAGANENGPGNYIADITSYDYDAPMTEAGDPTPKYL
ALRKIIARYLPLPSLPVPEPVPKRAYGTVRLVSCCTLFATGTRQKLATGMVQAPRPKTFE
ALGQYSGLVLYETWLPRFKRDPSILNVAGLADRGYVYVDNEYVGLLARETPVFSIPLSAS
AGRRLQILVENQGRINFGRQLNDFKGITRDVRLDKQLLTNWNMTTFPLDSFESLEELISQ
SNEAASMGFQELRKPQHMLRSGPAIYHGMLDIIQEADLADTYLDMSGWGKGIVFLNGENL
GRYWPLVGPQVTLYVPSPVLKVGTNSIVVVEYQQAPASTELHFRDTPILNARTG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtatttatcctcgttcaatttacattctctttggagcaagatgaagctcggcctgatg
atcgtggcgtccctttggggcgtcgtttccctaatgggggcagcacatgggaatcgaact
ttcacggtggattacgcaaatgatcagtttttgaaggacggtgtgtccttccgttttatt
gccggatcgtttcactatttccgcgcccatcccgccacctggcagaggcatttgcggaca
atgcgagcagccggactcaatgcggtgaccacctacgtggaatggtcgatgcacaatccc
cgggatgggacgtacgtgtggacgggcatagccaatttggaacactttatccgcctggct
gtggccgaggacctgctggttatccttcgtccaggtccgtacatctgtgcggaacgtgat
atgggcggctttccctactggctgctcaaaaagtatccgaacatccaactccgcactgcg
gatgtcaactatctcagtgaggtacgcatctggtataaccagctcttcacccgtatggtt
ccttatctgtacgcgaatggcggacccatcataatggtacaagtggagaacgaatatggc
tcgtactttgcctgcgactccaaataccggacatggctgcgcgacgaaacagagagccat
gtgaagggccacgccgtgctcttcaccaacgacgggcccagcgttctgcgctgcggcaag
atcgaaaacgttctggccaccttggactttggggctaccaatgatctggacgcaacctgg
gcaaggttgaggcagtaccagcccaatggtcctttggtcaatgcggagtattatccaggt
tggcttacgcactggacggagcccatggccaatgtgagcacgaactcgattactggaact
tttataaacatgctggaccaaggggcaagtgtcaacttctacatgttctatggcggcaca
aactttggcttcactgcaggcgccaatgagaacggacctggtaactacatagcggacatc
accagctacgactacgatgcacccatgacagaggccggcgatcccacgcccaagtatctg
gctctccggaagattatcgcccgatatctcccgctgcctagcctgcccgttccggaaccc
gtgccaaagcgtgcctatggaacagtgcgtctggtcagttgctgcaccctgtttgccacg
ggaacacgccagaagctggccacaggtatggtgcaggctcccaggccgaagaccttcgag
gccttggggcagtactccggactggtgctgtacgagacttggttaccccgcttcaagcgt
gatccgagcatcctgaatgtggctggactggcagatcgtggctatgtctatgtggacaat
gaatatgtgggactgctggcccgggagacacccgtgttttcgattcctctgagtgccagt
gctggacggcgtctgcagatcctggtcgagaaccagggaaggatcaactttggacggcag
ctcaacgactttaagggaatcacgagggatgtgcggctagacaagcaactgctgaccaac
tggaacatgaccacattcccactggactccttcgaaagtctggaagagcttatcagccag
tccaatgaggcggctagcatgggcttccaggagcttaggaagccccagcatatgctccgc
tcgggaccggccatctaccacggtatgctcgatattatccaggaggcggacctggcagac
acctacctcgacatgtccggctggggtaagggcattgtcttcttgaacggcgagaatctc
ggccgctactggcctctggtggggccacaggtcaccctctatgttccctcgccggtgctc
aaagtcggcacgaatagcattgtggtggtcgagtatcaacaggctcctgcctccacggag
ctgcatttccgggacacacccatactgaatgccagaactggttag

DBGET integrated database retrieval system