KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA16655Help
Entry
Dpse_GA16655      CDS       T01032                                 

Definition
GA16655 gene product from transcript GA16655-RA (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dpse_GA16655
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Dpse_GA16655
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Dpse_GA16655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 187 aa AA seqDB search
MVKVWFMDDEQETDQRLEHHRSPPDYLELPELYQKTGVEYFKINADDYQNDAILGELRAK
RGYTYDDEITCSEKCLPDYANKLKNFFTEHLHTDEEIRLVLDGSGYFDVRDNEEQWLRIQ
VVKGDLIIIPAGIYHRFTLDSNNFIKARRYFVGEPVWTPHNRPADDLDCRKSYLKHQAES
FVQLNQV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagtatggtttatggacgacgagcaggagaccgatcagcgactggagcatcat
cgcagtccgccggactatctggagcttcctgaactgtaccagaagacgggcgtggaatat
ttcaagatcaacgctgacgattaccaaaacgacgcgattctaggggagctgcgggccaaa
cgtggctatacctacgatgatgagatcacctgctcggagaagtgccttccggactacgcc
aataagctgaagaacttttttacggaacatctgcatacggacgaggagatacgtttggta
ttggatggatcgggatactttgatgtccgcgacaacgaggagcagtggctgagaatacaa
gtggttaaaggagatttgattattattccggcgggtatatatcatcgtttcacgttggac
tctaataactttatcaaagcccgtcgctattttgttggagaacccgtctggaccccgcat
aatcgtcctgcagatgatttggattgccgcaagtcctacctgaagcatcaagctgagagt
tttgtgcaattaaaccaggtctaa

DBGET integrated database retrieval system