KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA16909Help
Entry
Dpse_GA16909      CDS       T01032                                 

Definition
GA16909 gene product from transcript GA16909-RA (EC:5.-.-.-)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dpse_GA16909
   00052 Galactose metabolism
    Dpse_GA16909
Enzymes [BR:dpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dpse_GA16909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 376 aa AA seqDB search
MPITLEEEIFGLAVNPFTKAPEMVRRYTLTNSNRMSISVIQLGAIIQSVRMPDAYEKVDD
ICLGFDDIASYVATKGAYIGGTLGRVANRVANGEYVVGETKVELTKNFQNKYQLHGGLVG
FDSVIWEVVQKTEDGIVFRHVSAHGHEGYPGTLTCLITYWLDNQNRIGVQFEATTDRKTV
VNISNHAYFNLAGHSAGPKGLAEHTVEIAASKIVETDDQQIPTGQLVDVDDTVFDLRLPV
LLGDRLMQFGGSLIDGYDNCFVVNGGSTQPGLSMIAKLVHPPSCRVMEVWTNQPGLQFYT
ANNLPNEKSGEFPMIGKDCTHYVKHGSFCVETEKFPDSMNHPEFPSIFLEPGEKYQHEVM
YWFKVEESWKCCCNNK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcacactggaggaggagatctttggcctggccgttaatcccttcacaaaggca
cccgagatggtgcgccgctacacgctgaccaactcgaaccggatgtccatttcggtgatt
caactgggcgccatcatccaaagcgtacgaatgccggatgcctatgagaaggtcgatgac
atctgcttgggattcgatgacattgcgagctacgtggctaccaaaggggcctacattggc
gggaccctcggacgggtcgctaaccgagtggcgaacggcgaatacgtggtgggtgaaaca
aaggtcgagctgaccaagaacttccagaacaagtaccagctgcacggcggccttgtgggc
ttcgacagcgtcatatgggaggtggtgcagaagacggaggacggcattgtctttcgccat
gtctcggcgcatggccacgagggctacccgggcacactgacttgcctcattacctactgg
ctggacaaccagaatcgcattggcgtgcaattcgaggccaccaccgacagaaaaaccgtt
gttaatatctccaatcatgcgtacttcaacctggccggccacagcgctgggcccaagggt
ctggccgagcatactgtggagatagctgccagcaagattgtggagacggatgatcaacag
ataccaaccggccagttagtcgacgtcgatgatacggtcttcgatctgcggctgcccgtc
ctgctgggcgaccgcctcatgcagttcggcgggagtctgatcgatggctacgataactgc
tttgtggtcaatggcggcagtacgcagccgggcctgagtatgatcgctaagcttgttcat
cctcccagttgtcgggtcatggaggtatggacaaatcaaccagggctgcagttctacacg
gccaacaatctgcccaacgaaaagagcggcgagttccctatgattggcaaggactgcact
cactacgtcaaacacggctccttttgcgtggaaaccgaaaagtttcccgactccatgaac
catcccgaattcccttcgatttttctggagcccggcgaaaaataccagcatgaggtcatg
tactggttcaaggtggaggagtcctggaagtgctgttgtaacaacaagtga

DBGET integrated database retrieval system