KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17089Help
Entry
Dpse_GA17089      CDS       T01032                                 

Definition
GA17089 gene product from transcript GA17089-RA (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dpse_GA17089
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   Dpse_GA17089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 960 aa AA seqDB search
MANKSKSESNYELDKNVTAIFDVRKALGKGAYGIVWKAIDKRQRDTVALKKIYDAFRDTT
DAQRTYREVIFLRAFRHHPNIIRLLGIYRATNNMDFYLVFEHMESDLHIVIKKRDILKDI
HRQFVMYQLVNAIKYVHSGNVIHRDLKPSNILIDSKCRLKVGDFGLARTVLVKPSERGTG
DATGLHDAPTENEGMMSDYVATRWYRAPEILVGCRRYTKAVDMWSLGCILGEMITEQPIF
QGSSTINQMEKILSALPNVTQREIDDIGNRFGTSLLCRSIRRDYQHSLNAMCRGCTSNEI
GFTTALLMLDPNDRITASKALKHPFVSSFRCPSAEMEMRLNVQPPLRDDYRFALDDYRNS
LYGMISKELGAGHRITQSCRTPTTVPRHSAALRELPFGCRTSALSSMRKPCALVPSTPRN
NQNRICADPQQKCSNACCKVQQLNSHSQSRPHSLGQAQAHTQSMEELPRRPHYHKHSSNF
GFKGHPLSPPTPPQRVDGERTQLKGHRSHVPAAQRELREHERPVVVTTPRVVAQPKEMEK
LKERVKERVMERVKERVRIREKEKIQFQTQARAYVETQATGKQKGAHDWVEKLGPTTLAS
SQDAREPQGEAGLLKPPKARISKQKHREQPKSVQTSVKLEHEAIVVQKEPQDIVDHNQNP
NPNPNPDPDPNPKPNLSHRKVRKREKELLQAPPDRRSDNTRNEKSLLLEALLRRKQRETN
SQDPDMDAKVQSNLDKLQADRKKMEKKILKYAAETGLMFISENLKNNGSDRSKTVYSSDS
ETYFTPKSRKTLVKKTLIKKYKPNRDVKHHGNHITELHESTSSYKFKKQQHDVFDASEKG
EQQVGDAKHFLEAKYCLTHELPRHEMEKHRYDSIIPSGARQSPDDSFNTRPTPGKYHTIL
KPMYLDLFSTLASAPAPAQTLPSSHTVKEPRRRKHISGDNFQPLHQRHISEIQAARINND
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacaaatccaagtcggaatccaactatgagctggacaagaacgtgacggcaatt
ttcgatgtgcgaaaggccttgggcaagggtgcctatgggattgtgtggaaggccatcgac
aagcggcaaagggatacagtggccctgaagaagatctacgatgcgtttcgcgacacgacc
gatgcccagcgcacgtatcgggaggtgatcttcctgcgggcctttcgccatcatccgaac
atcatccgactcctggggatatacagggccaccaacaatatggacttttatttggtgttc
gagcacatggaaagcgatctgcacattgtcatcaagaagagggacatcctcaaggacatc
cacaggcagttcgtaatgtaccagttggtcaatgccattaagtacgtgcattcgggcaac
gttatccatagggatctgaagcccagcaacatactgatcgacagcaagtgcagactgaag
gtgggggactttggactggcgcgcacggttttggtaaagcccagcgaaagagggactggc
gacgccaccggcctccacgacgcgcctactgagaatgaaggcatgatgtccgactatgtg
gccacgcgctggtatcgtgcccccgagatactcgtgggttgtcgcaggtacactaaggcc
gtcgatatgtggagtctgggctgcatcctgggcgagatgataaccgaacagccgatcttc
cagggcagcagcaccatcaatcagatggagaaaatattgtctgccctgccgaatgtgacc
cagcgcgagatagacgatattggaaacagattcgggacttcgctgctctgccggtcgatc
cgacgcgactaccagcactccctgaacgccatgtgtcgcggctgcacctccaacgagatt
ggtttcaccaccgcgctgctgatgctcgatccgaacgaccggatcacggccagcaaggcc
ctcaagcatccgtttgtgagctcctttcgttgcccttcggcggagatggaaatgcgactg
aatgtgcagccgccgctgcgcgacgattaccgcttcgcgctggacgactatcgtaacagt
ctgtacgggatgatctccaaggagttgggtgccggccatcggattacccagtcctgtagg
accccgaccacggtgccaaggcattcagctgctctacgggaactgcccttcgggtgccga
accagtgcattgagcagtatgcgaaagccatgtgcactcgtgccgagcaccccacgaaat
aaccagaataggatctgtgcggatccccagcagaagtgtagcaatgcgtgttgcaaagtg
cagcagctcaactcgcactcccaatcgcgcccccattccctaggccaggctcaagcgcac
actcagtctatggaggagctgccaaggcggcctcattaccacaagcacagctctaatttc
gggttcaaggggcaccccctctcaccgccgacccctccgcagagggtagacggagagcga
acccagctcaagggccatcgatcgcatgtgccagccgcacaaagggagttgcgggagcac
gagcgtccagtggtagtaacgacaccgcgtgtggtagcccagccaaaggaaatggaaaag
ttaaaggaaagggtaaaggaaagggtaatggaaagggtaaaggaaagggtaaggataagg
gaaaaggaaaagatccaattccaaacacaggctcgagcctatgtagagacacaagccaca
ggcaagcaaaagggtgcacatgactgggtcgagaagcttggtccaaccaccttggctagt
tctcaggatgctagagagccccagggcgaggccggcctcctgaagccgcccaaggcaaga
atttccaagcagaagcacagagagcagccgaagtcagttcaaaccagtgtcaagctcgag
cacgaggccatagtcgtccagaaggaaccgcaggacatagtggaccataaccagaacccg
aacccgaacccgaacccggacccggaccccaacccgaaaccgaacctaagccatcggaaa
gtgaggaagcgggagaaggaactactgcaggcgccaccggacaggcgctcggacaacaca
aggaacgagaagagccttcttctcgaggcattgctgcggcggaaacagcgcgaaacaaat
tcccaggaccccgatatggatgccaaagtgcaatcgaatttggataagctccaggccgac
aggaaaaagatggagaagaagatccttaagtatgcggcggaaaccggactgatgttcatc
agcgaaaatttgaagaataacggctcagaccgctccaaaacggtatattcttcagactcc
gagacctattttacaccaaaatctcgtaagacgttggtaaagaagacactgattaagaaa
tataaacccaaccgggacgtaaagcaccacggaaatcacataacggagctccacgaatcc
acctcgtcctacaagttcaagaagcagcagcacgatgtcttcgatgcatcggaaaaaggc
gagcagcaggtgggcgatgccaaacattttttggaggcaaagtactgcctaacccatgag
ctccctcgccacgagatggaaaaacatagatacgattccataatcccttcaggagctcgc
caatcgccagacgattcattcaacactagacctacacctggcaaatatcacacaatcctg
aagcccatgtatttggatttgttttcgactctggcatcggcaccggctccggcacagacc
ctgccctcgagccacacagtgaaggagccccgtcgcaggaagcatatttctggagataac
ttccagcccctgcatcagcgacacatcagcgagatccaggcggctcgcatcaataacgac
tag

DBGET integrated database retrieval system