KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17100Help
Entry
Dpse_GA17100      CDS       T01032                                 

Definition
(RefSeq) GA17100 gene product from transcript GA17100-RB
  KO
K06091  
MAGUK p55 subfamily member 5
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dpse_GA17100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1757 aa AA seqDB search
MQGNSSRSTLSAQSSGTPSASTISSSQGKQQVVELSGYVIILVENVEGKIKLYGSPPDRD
NLEVGDEILEVNGLSLENISRTEVIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLQQSGKSGTTTSQKPQDLSFLNDSTPI
YVTSFTSNQITCCSSTMTTATAGGPISAPMLAPTTATCTMPTPAVEQQAASQGASALVSA
AVAAATAADRNANSTTAAALKQQRQKQLPSSACNTATAISAVATSSSTSSATGQIYQASQ
AQQQQLQQLQQQLAAAAAAGKPLQAKSLLATSLQHLAEEVDNEDLDDDDDDVDGANYCGI
TYISYNNKHAQLPTTTLPASTTLPAAAATLATTAAIHQQRQQQTHAQTHNRPAPLQLCAS
DVQFVDAGTSTSPLLAATSIVTAADIALPPSGGHLHGTTTPKTEYSTAISSGQLQQAFAE
LQLQYSTNNNTSQQQQHQHQQQQPQPQTQTHFHQQHLILSNNNNSNNSIASSGITTAAAT
AATAAATAASVMKNCDLLIANNLYPPRRELLDDVIVHQSSDVHAYNTNVATANSSNNRSQ
QQQQQLLSAAYELQQQQLLQQQQQQQLQHSPTSSISIGRTELLLGDQSLRQDSSRNRRRS
GSSIVVLDGDDLKPCLPPFMRLTEQGADGRLVQSSPSRAALPTRHLQQQAAAAAAAATGK
RRVTATAIAADVGSGTTATPSKGQTPVDDQTLASSNTCHTSNTSNSNSLKQQQQLHAHQQ
QQATSHIATKPWPHPAMSQWWHCWPPLPPMTKHRELPVDVPDSFIEIVKTPPPRYPAPAH
LSSRGSLLSSNGSASTAQTTLSSLPPAPVAAVGPATAAVAATATATATAGGGGSVSGIGG
DAKRVSDELNGNAKPVPPPRDHLRVEKDGRLVNCSPAPQLPDRRAAGNGNGSSGSHSQQH
HLQQLHHQQQQQHLHHQQQQIAQIVEPTLEQLDSIKKYQEQLRRRREEEERIAQQNEFLR
NSLRGSRKLKALQDSATPGKAIAMAQQQQPAPTGLAAMPMPAGVENEAYLPDEDQAQPQL
QPQPEQIDGYGELIAALTRLQSQLSKSGLSTLAGRVSAAHSVLASASVAHVLAARTAVLQ
RRRPRVSGPLHHNALGLQKDIVELLTQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTD
GTPSPTPTPTPAGGLGSMSGASSPVSAAKRAAMAGGVVVPPPVVPVPSTLAQRGAMPLPR
GESPPPPPLPMPMPMAMPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGR
IVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSGG
LGGLGLPGSLAGSGGPGSGLGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVL
HVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRETMKLAIAEEAGLARSRGKDGASS
KGATLLCARKGRKKKKKASSEAGYPLYATTAPDETDPEEILTYEEVALYYPRATHKRPIV
LIGPPNIGRHELRQRLMADSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARR
FVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDK
LRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLER
EPQWVPAQWVHNNRDES
NT seq 5274 nt NT seq  +upstreamnt  +downstreamnt
atgcaagggaacagcagccgatccacgttaagcgcacaatcctcgggcacaccgtcggcc
tccacgatatcctcgtcgcagggaaagcaacaagttgtcgaactatcaggctatgtcatc
atactcgtcgagaatgtggaggggaagattaaactatatggctcaccgcccgatcgcgat
aatctggaagtgggcgatgagatactcgaggttaatggcctttccctggagaacatatcg
cgcacggaggtcatacgccacatacacgattgcatcaaatcctgtacgatctgtttgcgg
gtgcgcaagaagaatgattcccgattggcctgggatattgggaattcggtgcaggacgcg
tttgtcattgccgtcgaggagcacgcccgggagcgactgcagcgattggcggctctcaat
cgagtgacgcccgtggacataacccaactgtcgaagaagctgcagcaaagtggaaagagc
ggcacaacgacaagccagaagccgcaggacctcagtttcctgaacgactcgacgcccatc
tatgtgacgtccttcaccagcaaccagatcacgtgctgcagctccaccatgacaacggcc
acggcgggcggccccatctccgccccaatgctggcacccaccacagcgacctgcacaatg
cccacgcccgccgtcgagcagcaggcggccagccagggggcctccgcgctggtaagtgcc
gctgtggcagcggccaccgccgccgatcgcaatgccaacagtaccaccgcagcggccctc
aagcagcagaggcagaagcagcttccgagctccgcgtgcaataccgccacagcgatcagc
gccgtcgcgacaagcagctcgaccagcagcgccaccggacagatctaccaggcgagccag
gcccagcagcagcagctgcagcagctccagcagcagctggcggcggccgccgctgcgggg
aagcccctccaggccaagtccctgctcgcgaccagcctccagcatctggccgaggaggtg
gacaacgaggacctcgacgacgacgacgacgacgtggacggggccaactattgcggcatc
acctacatctcgtacaacaacaagcatgcccagctgccaacgacgacgctgccggccagc
acgacgctcccggcggcggcggccacccttgccaccacggcggcgatccaccagcagcgg
cagcagcagacccacgcccagacccacaaccgccctgccccactgcagctgtgtgccagc
gatgtccagttcgtggatgccggcacctcgacgtcgcccctgctggccgccaccagcatt
gtgacggcagcggacatcgccttgccgccgagcggcggccatctccacggcacaacgacg
cccaagaccgagtactcgacggccatttccagcggacagttgcagcaggcctttgccgag
ctgcagttgcagtactccaccaataacaacacctcacagcagcagcagcaccagcaccag
cagcagcagccacagccacagacacagacacatttccatcagcaacatttaattttaagc
aacaacaataatagcaataattccatcgcatccagcggcatcacgacagcagcggccaca
gcggcaacggcggcagccacagcggcatccgtgatgaagaattgtgatctactgatagcc
aacaatctgtatccaccgagacgagagttactagatgacgtcattgttcatcaatccagc
gatgtccatgcatacaacaccaatgtagcgacagccaacagcagcaacaatcgatcccag
cagcagcagcagcaattgctgagtgccgcctacgagctgcagcagcaacaactcttgcaa
cagcagcagcagcagcagctgcaacacagtcccacaagtagcatatcaataggaagaaca
gaacttttattgggtgatcagagtctgcggcaggactccagcaggaaccgccggcgctcc
ggctcaagcatagttgtcctggacggtgatgatctgaagccatgtctcccgccattcatg
cgtctgacagagcaaggggcggatggtcgcctcgtgcaatcttcgccgtctcgggcagca
ttgcctacccgccacttgcagcagcaagcagccgcagcagcagcagcagcaacaggcaag
cgacgagtaacggcaacagcaatagcagcggatgtgggaagtggaaccactgccacgccc
agcaaggggcaaacgcctgtggacgatcagaccttggccagcagcaacacgtgccacaca
agcaacacaagcaacagcaattcgctgaaacagcagcaacagctccatgcacaccagcaa
cagcaggccaccagtcacattgcaactaagccttggccccacccggctatgagccagtgg
tggcactgctggccgcccctgccaccgatgaccaagcaccgggagctgcccgtcgatgtg
cctgacagcttcattgagatcgtgaagacgccgccgccgcgatatcccgccccggcacat
ctctcctcgcgcggatcgctgctctcctccaatggcagtgcctccacggcccagaccacg
ctctcctcgctgcctcctgcccctgttgccgctgtggggcctgccactgccgctgtcgct
gccactgcaactgcaactgcaactgctggtggcggtgggagtgtcagtggcataggcggc
gatgcgaagcgggtgtctgatgagctcaacggcaatgccaagcccgtgccaccgccccga
gatcatctacgggtggagaaggacggccggctggtcaactgttcgcccgccccccaactg
ccggatcgtcgggcagcgggcaacggcaacggcagcagtggcagccacagtcaacaacac
cacctgcagcagttgcaccaccaacagcagcagcagcatctgcaccaccagcagcagcag
atcgcccagattgtggagcccacgctggagcagttggatagcatcaagaagtaccaggag
caactgcgccgccgacgcgaggaggaggagcgcatcgcccagcagaatgagttcctgcgg
aacagtctgcgcggctctcgcaagctgaaggcgctccaggactcggccacgcccggcaag
gccatcgccatggcccagcagcagcagccggcgccgacgggactggcagccatgcccatg
cccgccggtgtggagaacgaggcgtatctgccggatgaagatcaggcgcagccacagctg
cagccgcagccagagcagatcgatggctacggcgagctgatcgcggccctcacccgcctc
cagagccagctgagcaagagcggcctcagcacgctggccggacgcgtctcggcagcccac
agcgttctggccagcgccagtgtggcccacgtgctggccgcccgtaccgccgtcctgcag
cgccgacgcccccgcgtcagcggccccctgcaccacaacgccctcggcctgcagaaggac
atcgtggagctgctcacccagtcgaacaccgcggcggccatcgagctgggcaacctgctc
accagccacgagatggagggcctcctgctggcccacgaccgcatcgccaaccacacggac
ggcacgccctcgcccacgccgacgcccacacccgccggtggattgggttcgatgagcgga
gccagcagtccggtgtcagcggcgaagagagcggcgatggccggtggggtggtggtgcca
ccaccggtggtccccgtcccgtcaacgctggcgcagcgcggagcaatgccgctgccgcgg
ggcgagtcgcccccaccgccgccgctgccaatgccaatgcccatggccatgccgatgagt
gcctgctttggaacgctcaacgaccagaacgacaacatccgaataatccagatcgagaag
tcgacggagccgctgggcgccaccgtgcgcaatgagggcgaggcggtggtcattgggcgg
atcgtgcgcggcggagccgccgagaagtccggcctgctccacgagggcgacgagatcctg
gaggtgaacggccaggagctgcgcggcaagactgtgaacgaggtgtgcgccctgctcggt
gcgatgcagggcacgctgacgttcctcatcgtgccggcgggcagtccgccgtctgggggc
cttgggggcctcggccttcccggcagtctggccggcagcggcggacccggctcagggctg
ggggcacaccgggacacggccgtgctgcatgtacgggcgcacttcgactacgacccggag
gacgatttgtacattccgtgccgggagctgggcatcagcttccagaagggcgatgtgctg
cacgtgatcagccgcgaggaccccaactggtggcaggcgtaccgcgagggcgaggaggac
cagacgctggccggcctcattcctagtcagtcgtttcagcaccagcgcgagaccatgaag
ctggccatcgccgaggaggcgggcctggcccgctcccgtggcaaggacggggccagcagc
aagggtgccaccctgctctgtgcgcgcaagggtcgcaaaaagaagaagaaggccagctcc
gaggcaggctatcccttgtacgccacgacggcgccggacgagaccgatccggaggagata
ctcacctacgaggaggtggccctgtactatccgcgggccacccacaagcggcccatcgtc
ctgatcggaccgcccaacatcggacgccacgagctgcgccagcgcctgatggcggactct
gagcgcttctccgccgcagtgccacacacatcacgtgcccggagggagggcgaggtgccc
ggtgtcgactatcacttcatcacgcgccaggccttcgaagcggatattctggcccgtcgc
ttcgtggagcacggggagtacgagaaggcctactacggcacatcactggaggccatacga
acggtggtggccagcggcaagatctgcgtcctcaatctgcatccgcagagcctgaagctt
ctgcgagcctccgacctcaagccctatgtggtactggtggcgcctcccagcctcgacaag
ctgcggcagaagaagctgcgcaatggggaaccattcaaggaggaagagctcaaagacatc
attgccacggccagggacatggaggcccgatgggggcatctcttcgacatgatcatcatc
aacaatgacacggagcgcgcctaccaccagctgctggccgagatcaattcgctggagcgc
gagccgcagtgggtgcccgcccagtgggtgcacaacaatcgggacgagtcatag

DBGET integrated database retrieval system