KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17214Help
Entry
Dpse_GA17214      CDS       T01032                                 

Gene name
Dpse_Adh
Definition
GA17214 gene product from transcript GA17214-RA (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dpse_GA17214 (Dpse_Adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dpse_GA17214 (Dpse_Adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Dpse_GA17214 (Dpse_Adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dpse_GA17214 (Dpse_Adh)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA17214 (Dpse_Adh)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA17214 (Dpse_Adh)
   00982 Drug metabolism - cytochrome P450
    Dpse_GA17214 (Dpse_Adh)
Enzymes [BR:dpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dpse_GA17214 (Dpse_Adh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 254 aa AA seqDB search
MSLTNKNVVFVAGLGGIGLDTSRELVKRNLKNLVILDRIDNPAAIAELKAINPKVTITFY
PYDVTVPVAETTKLLKTIFAQVKTIDVLINGAGILDDHQIERTIAVNYTGLVNTTTAILD
FWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGSKAAVVNFTSSLAKLAPITGVTAYTVN
PGITKTTLVHKFNSWLDVEPRVAEKLLEHPTQTSQQCAENFVKAIELNKNGAIWKLDLGT
LEPITWTQHWDSGI
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaccaacaagaacgtcgttttcgtggccggtctgggcggcattggcctggac
accagccgggagttggtcaagcgtaatctgaagaacctggtcatcctggatcgcattgac
aatccggctgccattgccgaactgaaggcaatcaatcccaaggtgaccatcaccttctat
ccctacgatgtgactgtgcccgtcgctgagaccaccaagctcctgaagaccatctttgcc
caggtgaagacaatcgatgtcctgatcaacggtgctggcatcctggacgatcatcagatc
gagcgcaccattgccgttaactacacgggcctggtcaacaccaccacagccattctggac
ttctgggacaagcgcaagggcggcccaggcggcatcatttgcaacattggctccgtcacc
ggtttcaatgccatctaccaggtgcccgtttactccggctccaaggcggcggtggttaac
tttacctcctccctggcgaaactggctcccattactggtgtcactgcttacactgtcaat
cctggcatcacgaagaccactctggtccacaaattcaactcgtggctggatgtggagccc
cgtgtggcggagaagctgctcgagcatcccacccagacctctcagcagtgcgccgagaac
tttgtgaaggccattgagctgaacaagaacggtgccatctggaagttggatctgggcacc
ttggagcccatcacatggacccagcactgggactcgggcatctaa

DBGET integrated database retrieval system