KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17312Help
Entry
Dpse_GA17312      CDS       T01032                                 

Definition
GA17312 gene product from transcript GA17312-RA (EC:2.4.1.18 3.2.1.-)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dpse_GA17312
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dpse_GA17312
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA17312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 690 aa AA seqDB search
MGDAMNVKVKDIETLFSTDGYLRPFEREIRRRHGVLQEWLDKINQGDGGMDQFTQGYKYY
GLHFQPDNSVIAREWAPGAKNVYLAGDFNNWHWESHPFKKLEFGKWELHLPPNADGSPQI
KHLSEIKIIIRNHSDHLLDRLSPWAKYVVQPPKEANQGVNYKQYVWQPPESERYQRQHSR
PARPKSLRIYECHVGIASQEPRVGTYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFG
YQVTSFYAASSRCGNPEQLKRMIDVAHSHGLYVLLDVVHSHASKNVQDGLNQFDGTNSCF
FHDGARGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIG
EGFSGDYNEYFGLNVDTDALNYLGLANHMLHTLDPEVITIAEDVSGMPTLCRPVSEGGIG
FDYRLGMAIPDKWIELLKEQSDDQWSMGDVVHTLTNRRWMENTVAYAESHDQALVGDKTI
AFWLMDKEMYTHMSTQSDSSLIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLD
FPRVGNNDSYHYARRQWNLVDDNMLKYKYLNEFDRAMNEAEQRYGWLHSGPAYVSWKHEG
DKIIAFERAGLVFVFNFHIHQSFTGYRVGTNWAGTYQAVLSSDDPRFGGHNRIDGNVKHR
SDPEGYAGRSNFIEVYSPSRTAVVYARVSD
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgccatgaatgttaaggttaaggacatcgagacactattctcaacggatggc
tacttgaggcctttcgagcgtgagatccgacgacgacatggcgtactccaggagtggctg
gacaagatcaaccaaggcgatggcggaatggaccagttcacgcagggatacaaatactac
ggcctgcactttcagccggacaactcggtgattgcccgggagtgggcaccgggggccaag
aatgtctatctggcaggcgacttcaataactggcactgggagtcgcatcccttcaagaaa
cttgagtttggcaagtgggaactgcatctgccccccaatgcggatggcagtccacagatc
aagcacctgagcgagattaagatcatcattcggaaccattctgatcacttgctggatcgc
ctgtcgccctgggccaagtatgtggtgcagccaccaaaggaggccaaccaaggggttaac
tacaagcagtacgtgtggcagccaccagaatcggagcgctaccagcgccagcattcccgt
ccagccaggcccaaatccttaaggatttacgagtgccatgtgggcattgcctcgcaggag
ccgcgcgtgggcacctacgacgagttcgccgatcgcattgtgccccgcatcaagcggcag
gggtacaactgcatccaggtgatggcgatcatggagcacgcctactatgccagctttggc
taccaggtgaccagcttctatgccgcctccagccgctgcggcaacccagaacagttgaag
cgaatgattgatgttgcccattcccacgggctgtacgtcctgttggatgtcgtccactcg
catgcctcgaagaatgtacaggatggcttgaaccagtttgacggcaccaatagctgcttc
ttccacgacggagcccgcggcgagcactctctgtgggacagtcgtctgttcaactatgtg
gagtacgaggtgctgcgcttcttgctgtccaacctgcgctggtggcacgacgagtacaac
tttgatggctaccgtttcgatggcgtcacctcaatgctgtaccactcgcgaggcattggc
gagggcttcagcggcgactacaatgagtactttggcctgaatgtcgacacggatgctctc
aactatctggggctggccaatcatatgctgcacacgctggaccccgaagtcatcaccatt
gcggaggatgtctcgggaatgccgactctgtgccgtcccgtctcggagggcggcattggc
ttcgattatcgcctgggcatggctataccggacaagtggattgagctgctcaaggagcag
agcgacgaccaatggagcatgggggacgtggtccacaccctaaccaatcgccgctggatg
gaaaatacggtggcgtacgcagagtcgcacgatcaggccctggtcggggacaagaccatt
gccttctggctgatggacaaggaaatgtacacgcacatgtcgacgcagtcggactccagc
ttgattatcgatcgtggcctggcactgcacaagatgatacgcctgatcacacatgccctc
ggcggagaggcctatctgaacttcatgggcaatgagtttggacatcccgagtggctggac
ttcccccgcgtgggcaacaacgactcgtaccactatgcccgtcggcagtggaacctggtg
gacgacaacatgctgaagtacaaatacctcaatgagttcgatcgggccatgaacgaggct
gagcagcgctacggttggctgcattccggacccgcctacgtcagctggaagcacgagggc
gacaagatcatcgcctttgagcgtgccggactggtcttcgtctttaacttccatatacac
cagagctttactggctaccgcgtgggcaccaactgggcgggcacctatcaggcggtgctc
tcctcagacgatcctaggtttggcggccacaaccgcatcgatggcaatgttaagcatcgc
tccgacccggagggatacgctggtcgttccaacttcattgaggtctacagcccatcacgt
actgccgtagtctatgcccgcgtcagcgattaa

DBGET integrated database retrieval system