KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17375Help
Entry
Dpse_GA17375      CDS       T01032                                 

Definition
GA17375 gene product from transcript GA17375-RA
Orthology
K05635  
laminin, gamma 1
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dpse_GA17375
Cell adhesion molecules and their ligands [BR:dpo04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      Dpse_GA17375
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      Dpse_GA17375
     Laminin-2 Extracellular matrix (ECM) components
      Dpse_GA17375
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      Dpse_GA17375
   VLA-3
      Dpse_GA17375
     Laminin-10 Extracellular matrix (ECM) components
      Dpse_GA17375
     Laminin-11 Extracellular matrix (ECM) components
      Dpse_GA17375
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      Dpse_GA17375
     Laminin-8 Extracellular matrix (ECM) components
      Dpse_GA17375
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      Dpse_GA17375
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      Dpse_GA17375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 1637 aa AA seqDB search
MKRSRWSLCGSSTARLLLVGVLLSCCTPDAFGAQRTPINSAGHELRATTFMPALECYDPY
GRPQKCLPEFINAAYQLQFESTNTCGEQSDTHFCIQNPNHKNCEFCRYEDHNPSFLTDLH
DPQNPSWWQSETMFEGIQHPNYVNLTLHLRKSYDITYVRILFRSPRPESFTIYKRTSENG
AWIPYQYYSATCRDTYFLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEGRPS
GINFERSLELQDWVTATDIRITLDRLNTFGDELFGDPQVLKSYFYAISDIAVGARCKCNG
HASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDVKWKRATSTEVNECKACNCNG
LADKCFFDAHLFNQTGHGGHCLDCRENRDGPNCERCKENFYMREDGYCVNCGCDSIGSRS
LQCNSQGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQPCGCDGRGSHENTPACDAESGICF
CKENVEGRRCNECKPGFFNLDKINRFGCTPCFCYGHTSECQTAPGYSIVSVASNFNKFKE
RWTAIDLNRREVDIKYNQYSRSIGTTAQGNEFVYFQAPDRFLGDQRASYNRDLKFKLQLV
GQVGPSTSANDVILEGAGSRISLPIFAQGNGIPDQNVKEYTFRLHEHHDYQWQPSQSARG
FLSILSNLTAIKIRATYSVQGEAILDDVELHTAHRGAAGHPATWIEQCTCPEGYLGQFCE
SCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTFGDNCDQCAKGFYGVA
LGGTPYDCKRCPCPNDGACLQINGDTVICTECPVGYFGSRCEQCSDGFFGDPTGLLGTVQ
TCTGCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLPGHFGDPLSLPHGKCDRC
SCYEAGTEQDEQSISRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVG
SFNSTCDRYSGQCHCKPGVVGLRCDQCANYFYGFSSEGCKPCECDESGSKGFQCDQSGQC
PCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAANLHRAKLANLSSTLDEIARTP
VTNDEEFEAKLRAVQEKVALLSQDARDNVGEGGQTYAEVIDDLHKRLDSVREHLQSADKL
QEDANVEIDKARKNYTILHDITENAKRELQQALDLLNDEGTQALAKAKDKSVEFGQQSQQ
ISDISREARALADKLESEAQFDLKNAKDAMDAVEKAHLLAKNAIDLQQKISVELRSEVRL
ELDQVKQSLGAVAQTSKEALRKANEVYDTALTLLNDVNRQSQPNIDINQLKRDAVAANER
ADLLLKQINELSNSNGEVFADFEEERTLAEVLLERADKQKQDDIELLNRAKTAHDKATKA
VEQGDNTLKEANNTYNTLAGFQSDVQRSSESAAQALQTVPNIELEIQNAESLIGQAGEAL
DGANKNANEAKKNAQEAQKKYAEQASKDAELIRRKANETKVAARNLRDEADQLNHRVKLT
EMDIFKLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANAELTAIKDELENLKDIN
TADLDKLENRLTIVEGEINRVNLTGRIEKYREQRTIQKNLIDKYGSELKELMKEVDNIGQ
ISKALPNKCFSRNRLEP
NT seq 4914 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagcaggtggagcctatgtggctcctccacggcgcgcttgctgctggtcggc
gtcctactttcctgctgtaccccagacgcgttcggcgcccaacgcacacccattaactcc
gccggacacgagctacgagccaccacgttcatgccggccctcgagtgctacgatccctat
ggcagaccgcagaaatgccttcccgagttcatcaatgccgcataccaactgcaattcgaa
tcgaccaacacctgcggcgagcagagtgacacacacttctgcatacagaatcccaatcac
aagaattgcgagttttgcagatacgaagatcacaatccctcatttctgacggacctgcac
gatccgcagaatccatcctggtggcaatcggagaccatgttcgaggggatacagcatccc
aactatgtgaatctgacgctccacttacgaaaatcctatgacatcacctatgtgcgaatt
ctgttccgctctcctcggcccgagtccttcacgatctataagcggacttcggagaacggt
gcctggattccctaccagtactacagtgccacctgtagggacacctacttcctgcccgac
tcccgggccatccgcaagggcgagggcgaggcccatgcactctgcaccagcgagtacagt
gacatttccccgctgcgcgacggcgagatcgcattctccaccctcgagggtcgtcctagt
ggcatcaatttcgagcgcagcctggagctgcaggactgggtcacggccaccgacatccgc
atcacgctggatcgcctcaacaccttcggcgacgagttgttcggtgatccccaggtgctg
aagtcctacttctatgccatcagtgacatcgccgtgggtgccagatgcaagtgtaacgga
cacgccagcaagtgcgtcgccagcacgggtatgcacggagagaggacgctggtgtgcgag
tgtcgccacaacaccgatggacccgactgtgaccgctgtctgcccctgtacaatgacgtc
aagtggaagagggccacctcaacggaagtcaacgagtgcaaagcctgcaactgcaatgga
ttggcggacaaatgcttctttgatgcccatctcttcaaccagacgggtcatggcggccac
tgcttggactgtcgcgagaatcgtgatggacccaactgcgaacgctgcaaggagaacttt
tacatgcgcgaggatgggtactgtgtcaactgtggctgcgactctattggatcccgctcg
ctgcagtgcaacagccagggcaagtgccagtgcaagccgggcgtgacgggggacaaatgc
gatcgctgcgacaacaactactaccagttcggacctcatggctgccagccctgtggctgc
gacggtcggggttcccatgagaacactccagcctgcgatgcggagagtggcatctgcttc
tgcaaggagaatgtggagggcaggcggtgcaatgagtgcaagcctggcttcttcaacctg
gacaagatcaatcgctttgggtgcacgccctgcttctgctacggccacacttccgagtgc
cagacggcaccgggctactcgattgtctccgtggcctccaacttcaacaagttcaaggag
cgctggacggccatcgatctaaaccgtcgcgaggtggacatcaagtacaaccagtacagc
cgcagcatcgggaccacggcccagggcaacgaattcgtctacttccaggcccctgatcgc
ttcctgggggatcaacgtgcttcatacaaccgcgacctcaagttcaagctacagctggtg
ggtcaggtggggccgagcaccagcgccaacgacgtgatcctggagggcgctggcagcagg
atctcgctgcccatcttcgcccagggcaacggcatccccgaccaaaatgtgaaggagtac
acgttccgtctgcacgagcaccacgattaccagtggcagccaagtcagtcggccaggggc
ttcctctccatcctctccaatctgacggccatcaagatccgtgccacctactcggtccaa
ggcgaggccattctcgacgatgtggagctgcacacggcgcatcgcggtgcagccggccac
ccggccacctggatcgagcagtgtacctgtcccgagggctatctgggccagttctgcgag
tcctgcgctcccggctaccgccatagcccggcccgaggtggacccttcatgccgtgcatc
ccctgtgactgccacggacatgccgacatctgcgactcggagaccggtcgctgcatctgc
cagcacaacaccttcggcgacaactgcgaccagtgtgccaagggcttttacggagtcgcc
ctaggcggaactccctacgactgcaagcgctgtccctgtcccaatgatggggcctgtctg
caaatcaacggcgacacggtcatctgcacggagtgtccagtgggatactttggctcccga
tgcgagcagtgcagcgacggcttcttcggagaccccaccggtctcctgggcaccgtgcag
acctgcacgggctgcgactgcaacggaaacgtggaccctaatgcggtgggtaactgcaac
cgcaccacgggcgagtgcctgaagtgtatccacaacactgccggagagcactgcgaccag
tgcctgcccgggcactttggtgacccgctctccctgccccacggcaagtgtgaccgctgc
agctgctacgaggcgggcacggagcaggacgagcagagcatttcgcgttgcgaccaggtt
accggccagtgccagtgcaagccaaacgtcatcggccgcgactgtggcgagtgccagccg
ggatacttcaacatacgctccgggaacgggtgcgaaaactgcctttgcgaccccgtgggc
agcttcaactccacctgcgaccgctactcgggccagtgccactgcaagccgggcgtggtg
ggtttgcgatgtgaccagtgcgccaattacttctacggcttctcctcggaaggctgcaag
ccgtgcgagtgcgacgagagcggctccaagggcttccagtgcgaccagagcggacagtgt
ccttgcaatgacaacgtggagggacgtcgctgcgaccgctgcaaagagaacaagtacgat
cgccatcgcggctgcatcgactgtccggactgctacaacctggtgcaggacgccgccaat
ctgcatcgcgctaagctggcaaacttgagctccaccctggacgagattgctcgcacgccg
gtgaccaatgacgaggagttcgaggccaagctgcgggcggtgcaggagaaggttgccctg
ctgtcccaggacgcccgcgacaatgtcggcgaaggcggccagacctatgcagaggtcatc
gatgacctccacaagcgactggacagcgtgcgggaacatctgcaaagtgcagacaaactg
caagaggatgccaacgttgagatagacaaggcccgcaagaactacacgattcttcacgat
attaccgagaatgcaaagagagagctgcagcaggccctcgatctactcaacgacgagggt
acccaggcattggccaaggccaaggacaagtccgtggagttcggccagcagtcgcagcag
atttcggacatttcacgcgaggcacgcgcactggccgacaaactggagtcggaggcgcag
ttcgatctgaagaacgccaaggacgccatggatgccgtggaaaaggcccaccttttggcc
aagaatgccatcgatctgcagcaaaagattagtgtggagctacgctccgaagttcggctc
gaactggaccaggtgaagcagtctctgggtgccgtggctcagacctccaaggaggcgctg
cgcaaggccaacgaggtctacgatacagcccttaccctccttaacgacgtgaacaggcag
tcacagccgaacattgacatcaaccagctaaagcgggacgccgtggcagccaacgagcgc
gccgatcttctcctcaagcagatcaacgagctgtcgaacagcaacggcgaggtctttgcc
gacttcgaagaggaacgcaccctggctgaggttctgctggagcgagctgacaaacagaaa
caagacgacattgagctgctgaatcgcgccaagactgcacacgacaaggccacaaaggca
gtggagcagggtgacaacacactgaaggaggcaaacaacacctacaatacgctggccggg
ttccagtcggatgtccagcggtcatccgagagtgctgctcaggcactgcaaacagttcca
aacatcgagctggagatacagaacgccgagagcctcatcggtcaggcgggcgaggcttta
gacggagccaacaagaatgccaacgaggccaaaaagaatgcccaggaggcgcagaagaag
tatgccgagcaggcctcaaaggatgcagagcttattcgccgcaaggcaaacgagacgaag
gtggctgccaggaacttgcgcgatgaggccgatcagctgaaccatcgcgtaaagctgacc
gagatggacatcttcaagctggaagaaagctccaccaaagacgacaatctcgtggatgat
gccaagcgaaaggtgggccaggccaaggccgacacacaggaggcgcagaagcagatcgag
aaggccaacgccgagctgacggcaatcaaggatgagctggagaatctgaaggacatcaat
acagctgatttggataaattggagaatcggttgactattgtcgagggcgagatcaatcgc
gtgaacctcacgggacgcattgaaaagtaccgggagcagcgcaccatacagaaaaatctg
atcgacaagtacggctccgagctgaaggagctgatgaaggaggtcgataacattggtcaa
atatcgaaggcactacccaacaagtgctttagtcgcaatcgtctggagccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system