KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17375Help
Entry
Dpse_GA17375      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05635  laminin, gamma 1
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    Dpse_GA17375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 4812747
NCBI-ProteinID: XP_001353125
FlyBase: FBgn0077388
UniProt: Q29CY8
Position
XR
AA seq 1637 aa AA seqDB search
MKRSRWSLCGSSTARLLLVGVLLSCCTPDAFGAQRTPINSAGHELRATTFMPALECYDPY
GRPQKCLPEFINAAYQLQFESTNTCGEQSDTHFCIQNPNHKNCEFCRYEDHNPSFLTDLH
DPQNPSWWQSETMFEGIQHPNYVNLTLHLRKSYDITYVRILFRSPRPESFTIYKRTSENG
AWIPYQYYSATCRDTYFLPDSRAIRKGEGEAHALCTSEYSDISPLRDGEIAFSTLEGRPS
GINFERSLELQDWVTATDIRITLDRLNTFGDELFGDPQVLKSYFYAISDIAVGARCKCNG
HASKCVASTGMHGERTLVCECRHNTDGPDCDRCLPLYNDVKWKRATSTEVNECKACNCNG
LADKCFFDAHLFNQTGHGGHCLDCRENRDGPNCERCKENFYMREDGYCVNCGCDSIGSRS
LQCNSQGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQPCGCDGRGSHENTPACDAESGICF
CKENVEGRRCNECKPGFFNLDKINRFGCTPCFCYGHTSECQTAPGYSIVSVASNFNKFKE
RWTAIDLNRREVDIKYNQYSRSIGTTAQGNEFVYFQAPDRFLGDQRASYNRDLKFKLQLV
GQVGPSTSANDVILEGAGSRISLPIFAQGNGIPDQNVKEYTFRLHEHHDYQWQPSQSARG
FLSILSNLTAIKIRATYSVQGEAILDDVELHTAHRGAAGHPATWIEQCTCPEGYLGQFCE
SCAPGYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTFGDNCDQCAKGFYGVA
LGGTPYDCKRCPCPNDGACLQINGDTVICTECPVGYFGSRCEQCSDGFFGDPTGLLGTVQ
TCTGCDCNGNVDPNAVGNCNRTTGECLKCIHNTAGEHCDQCLPGHFGDPLSLPHGKCDRC
SCYEAGTEQDEQSISRCDQVTGQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVG
SFNSTCDRYSGQCHCKPGVVGLRCDQCANYFYGFSSEGCKPCECDESGSKGFQCDQSGQC
PCNDNVEGRRCDRCKENKYDRHRGCIDCPDCYNLVQDAANLHRAKLANLSSTLDEIARTP
VTNDEEFEAKLRAVQEKVALLSQDARDNVGEGGQTYAEVIDDLHKRLDSVREHLQSADKL
QEDANVEIDKARKNYTILHDITENAKRELQQALDLLNDEGTQALAKAKDKSVEFGQQSQQ
ISDISREARALADKLESEAQFDLKNAKDAMDAVEKAHLLAKNAIDLQQKISVELRSEVRL
ELDQVKQSLGAVAQTSKEALRKANEVYDTALTLLNDVNRQSQPNIDINQLKRDAVAANER
ADLLLKQINELSNSNGEVFADFEEERTLAEVLLERADKQKQDDIELLNRAKTAHDKATKA
VEQGDNTLKEANNTYNTLAGFQSDVQRSSESAAQALQTVPNIELEIQNAESLIGQAGEAL
DGANKNANEAKKNAQEAQKKYAEQASKDAELIRRKANETKVAARNLRDEADQLNHRVKLT
EMDIFKLEESSTKDDNLVDDAKRKVGQAKADTQEAQKQIEKANAELTAIKDELENLKDIN
TADLDKLENRLTIVEGEINRVNLTGRIEKYREQRTIQKNLIDKYGSELKELMKEVDNIGQ
ISKALPNKCFSRNRLEP
NT seq 4914 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagcaggtggagcctatgtggctcctccacggcgcgcttgctgctggtcggc
gtcctactttcctgctgtaccccagacgcgttcggcgcccaacgcacacccattaactcc
gccggacacgagctacgagccaccacgttcatgccggccctcgagtgctacgatccctat
ggcagaccgcagaaatgccttcccgagttcatcaatgccgcataccaactgcaattcgaa
tcgaccaacacctgcggcgagcagagtgacacacacttctgcatacagaatcccaatcac
aagaattgcgagttttgcagatacgaagatcacaatccctcatttctgacggacctgcac
gatccgcagaatccatcctggtggcaatcggagaccatgttcgaggggatacagcatccc
aactatgtgaatctgacgctccacttacgaaaatcctatgacatcacctatgtgcgaatt
ctgttccgctctcctcggcccgagtccttcacgatctataagcggacttcggagaacggt
gcctggattccctaccagtactacagtgccacctgtagggacacctacttcctgcccgac
tcccgggccatccgcaagggcgagggcgaggcccatgcactctgcaccagcgagtacagt
gacatttccccgctgcgcgacggcgagatcgcattctccaccctcgagggtcgtcctagt
ggcatcaatttcgagcgcagcctggagctgcaggactgggtcacggccaccgacatccgc
atcacgctggatcgcctcaacaccttcggcgacgagttgttcggtgatccccaggtgctg
aagtcctacttctatgccatcagtgacatcgccgtgggtgccagatgcaagtgtaacgga
cacgccagcaagtgcgtcgccagcacgggtatgcacggagagaggacgctggtgtgcgag
tgtcgccacaacaccgatggacccgactgtgaccgctgtctgcccctgtacaatgacgtc
aagtggaagagggccacctcaacggaagtcaacgagtgcaaagcctgcaactgcaatgga
ttggcggacaaatgcttctttgatgcccatctcttcaaccagacgggtcatggcggccac
tgcttggactgtcgcgagaatcgtgatggacccaactgcgaacgctgcaaggagaacttt
tacatgcgcgaggatgggtactgtgtcaactgtggctgcgactctattggatcccgctcg
ctgcagtgcaacagccagggcaagtgccagtgcaagccgggcgtgacgggggacaaatgc
gatcgctgcgacaacaactactaccagttcggacctcatggctgccagccctgtggctgc
gacggtcggggttcccatgagaacactccagcctgcgatgcggagagtggcatctgcttc
tgcaaggagaatgtggagggcaggcggtgcaatgagtgcaagcctggcttcttcaacctg
gacaagatcaatcgctttgggtgcacgccctgcttctgctacggccacacttccgagtgc
cagacggcaccgggctactcgattgtctccgtggcctccaacttcaacaagttcaaggag
cgctggacggccatcgatctaaaccgtcgcgaggtggacatcaagtacaaccagtacagc
cgcagcatcgggaccacggcccagggcaacgaattcgtctacttccaggcccctgatcgc
ttcctgggggatcaacgtgcttcatacaaccgcgacctcaagttcaagctacagctggtg
ggtcaggtggggccgagcaccagcgccaacgacgtgatcctggagggcgctggcagcagg
atctcgctgcccatcttcgcccagggcaacggcatccccgaccaaaatgtgaaggagtac
acgttccgtctgcacgagcaccacgattaccagtggcagccaagtcagtcggccaggggc
ttcctctccatcctctccaatctgacggccatcaagatccgtgccacctactcggtccaa
ggcgaggccattctcgacgatgtggagctgcacacggcgcatcgcggtgcagccggccac
ccggccacctggatcgagcagtgtacctgtcccgagggctatctgggccagttctgcgag
tcctgcgctcccggctaccgccatagcccggcccgaggtggacccttcatgccgtgcatc
ccctgtgactgccacggacatgccgacatctgcgactcggagaccggtcgctgcatctgc
cagcacaacaccttcggcgacaactgcgaccagtgtgccaagggcttttacggagtcgcc
ctaggcggaactccctacgactgcaagcgctgtccctgtcccaatgatggggcctgtctg
caaatcaacggcgacacggtcatctgcacggagtgtccagtgggatactttggctcccga
tgcgagcagtgcagcgacggcttcttcggagaccccaccggtctcctgggcaccgtgcag
acctgcacgggctgcgactgcaacggaaacgtggaccctaatgcggtgggtaactgcaac
cgcaccacgggcgagtgcctgaagtgtatccacaacactgccggagagcactgcgaccag
tgcctgcccgggcactttggtgacccgctctccctgccccacggcaagtgtgaccgctgc
agctgctacgaggcgggcacggagcaggacgagcagagcatttcgcgttgcgaccaggtt
accggccagtgccagtgcaagccaaacgtcatcggccgcgactgtggcgagtgccagccg
ggatacttcaacatacgctccgggaacgggtgcgaaaactgcctttgcgaccccgtgggc
agcttcaactccacctgcgaccgctactcgggccagtgccactgcaagccgggcgtggtg
ggtttgcgatgtgaccagtgcgccaattacttctacggcttctcctcggaaggctgcaag
ccgtgcgagtgcgacgagagcggctccaagggcttccagtgcgaccagagcggacagtgt
ccttgcaatgacaacgtggagggacgtcgctgcgaccgctgcaaagagaacaagtacgat
cgccatcgcggctgcatcgactgtccggactgctacaacctggtgcaggacgccgccaat
ctgcatcgcgctaagctggcaaacttgagctccaccctggacgagattgctcgcacgccg
gtgaccaatgacgaggagttcgaggccaagctgcgggcggtgcaggagaaggttgccctg
ctgtcccaggacgcccgcgacaatgtcggcgaaggcggccagacctatgcagaggtcatc
gatgacctccacaagcgactggacagcgtgcgggaacatctgcaaagtgcagacaaactg
caagaggatgccaacgttgagatagacaaggcccgcaagaactacacgattcttcacgat
attaccgagaatgcaaagagagagctgcagcaggccctcgatctactcaacgacgagggt
acccaggcattggccaaggccaaggacaagtccgtggagttcggccagcagtcgcagcag
atttcggacatttcacgcgaggcacgcgcactggccgacaaactggagtcggaggcgcag
ttcgatctgaagaacgccaaggacgccatggatgccgtggaaaaggcccaccttttggcc
aagaatgccatcgatctgcagcaaaagattagtgtggagctacgctccgaagttcggctc
gaactggaccaggtgaagcagtctctgggtgccgtggctcagacctccaaggaggcgctg
cgcaaggccaacgaggtctacgatacagcccttaccctccttaacgacgtgaacaggcag
tcacagccgaacattgacatcaaccagctaaagcgggacgccgtggcagccaacgagcgc
gccgatcttctcctcaagcagatcaacgagctgtcgaacagcaacggcgaggtctttgcc
gacttcgaagaggaacgcaccctggctgaggttctgctggagcgagctgacaaacagaaa
caagacgacattgagctgctgaatcgcgccaagactgcacacgacaaggccacaaaggca
gtggagcagggtgacaacacactgaaggaggcaaacaacacctacaatacgctggccggg
ttccagtcggatgtccagcggtcatccgagagtgctgctcaggcactgcaaacagttcca
aacatcgagctggagatacagaacgccgagagcctcatcggtcaggcgggcgaggcttta
gacggagccaacaagaatgccaacgaggccaaaaagaatgcccaggaggcgcagaagaag
tatgccgagcaggcctcaaaggatgcagagcttattcgccgcaaggcaaacgagacgaag
gtggctgccaggaacttgcgcgatgaggccgatcagctgaaccatcgcgtaaagctgacc
gagatggacatcttcaagctggaagaaagctccaccaaagacgacaatctcgtggatgat
gccaagcgaaaggtgggccaggccaaggccgacacacaggaggcgcagaagcagatcgag
aaggccaacgccgagctgacggcaatcaaggatgagctggagaatctgaaggacatcaat
acagctgatttggataaattggagaatcggttgactattgtcgagggcgagatcaatcgc
gtgaacctcacgggacgcattgaaaagtaccgggagcagcgcaccatacagaaaaatctg
atcgacaagtacggctccgagctgaaggagctgatgaaggaggtcgataacattggtcaa
atatcgaaggcactacccaacaagtgctttagtcgcaatcgtctggagccctag

DBGET integrated database retrieval system