KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17377Help
Entry
Dpse_GA17377      CDS       T01032                                 

Definition
(RefSeq) GA17377 gene product from transcript GA17377-RA (EC:2.7.11.12)
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Module
cGMP signaling
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dpse_GA17377
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dpse_GA17377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 774 aa AA seqDB search
MARPMDDREREAIVQSLHKDVLSLKEMVRNRESELVKLHREIHKLKSVLQQTTNHLNVTR
NERNERLQQSPTKTKLYSLPEQCGEVTSSHANPHLCTSCGMVLPSSPEFAMEALSLGPPT
GKTTDTTATTAAPEMRPKPLPAAIKKQGVSAESCVQSMQQSYSAPIPKYEKDFSDKQQIK
DAIMDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEAGAHLYVSAAGEFAVMQNGK
VLDKMGPGKAFGELAILYNCTRTASIRVLSESRVWVLDRRVFQQIMMRTGLQRIENSVNF
LRSVPLLRNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPS
ALEETELRTLSRGDYFGEQALINEDKRTANIIALPPGVECLSLDTDSFKRLIGDLCELKE
KDYGDESRMLAMKAAAHSHEVLGAQAQAQQHQQEFPDLRLTDLEVVSTLGIGGFGRVELV
KAHHQGRVDTFALKCLKKRHIVDTKQEEHIFSERTIMLSSHCPFICRLHRTFRDEKYVYM
LLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERG
YVKLVDFGFAKHIGTSAKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILINELLNGTP
PFSASDPMQTYNLILKGIDMIDFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKH
KWFLGFDWDGLASQLLIPPFVRPIAHATDVRYFDRFPCDPVEPPDELSGWDADF
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcccggccaatggacgatcgggagcgcgaggcgattgtccagagcctgcacaaggac
gtgctgtccctcaaggagatggtgcgcaatcgagagagcgagctggtcaagctgcaccgg
gaaatccacaagctgaagagcgtgctccagcagaccaccaaccatctgaatgtgaccagg
aatgagcgaaacgagcggctgcagcagtccccgaccaagacgaagctctactccctgccc
gagcagtgcggcgaggtgaccagcagccatgcgaatccgcacctctgcacctcctgtggg
atggtgctgcccagcagcccagagttcgccatggaggcactctctctggggccacccaca
ggcaaaaccacagacacaacggcaacgacagcagcgcctgagatgcggcccaagcccttg
ccggcggccatcaagaagcagggagtgtccgccgagagctgcgtccaatccatgcagcag
tcgtacagcgccccgattcccaaatacgaaaaggatttcagcgataagcagcagatcaaa
gacgccatcatggacaacgacttcctcaagaacatagacgcctcgcaggtgcgcgagctg
gtggactcgatgtactccaagagcattgcggccggggagtttgtcattcgcgagggcgag
gcgggggcccacctgtacgtgtccgccgccggggagtttgcggtgatgcagaacggcaag
gtgctggacaagatggggccgggcaaggccttcggggagctggcgatcctctacaactgc
acgcgcaccgcctccatccgcgtgttgagcgaatctcgggtgtgggtgctggaccggcgc
gtcttccagcagatcatgatgcgcacgggcctgcagcggatcgagaacagcgtcaacttc
ctgcgatcggtgccgctgttgcggaatctcagcgaggagctgctggccaagatcgccgac
gtgctcgagctggaattctacgccgctgggacgtacatcatccgacagggcaccgccggc
gacagcttcttcctgatctcgcagggcaacgtgcgggtgacccagaagctgacgcccagc
gcgctagaggagacggagctgcgcaccctctcgcgcggcgactacttcggcgaacaggcg
ctcatcaacgaggacaagcgcacggcgaacattatagcccttccgccgggcgtggagtgc
ctctccctggacacggactccttcaagcggctgatcggggacctgtgcgagctgaaggag
aaggactacggggacgagagccgcatgctggccatgaaggcggccgcccacagccacgag
gtgctcggcgcgcaggcgcaggcgcagcagcatcagcaggagttccccgacctgaggctc
acggatctcgaggtggtcagcaccctgggcatcgggggcttcggccgcgtggagctggtc
aaggcgcaccaccagggccgcgtggacaccttcgccctgaagtgcctgaagaagcggcac
atcgtggacaccaagcaggaggagcacatcttcagcgagcgcaccatcatgctcagctcc
cactgtccgttcatctgtcgcctgcaccgcaccttccgcgacgagaagtacgtctacatg
ctgctggaggcctgcatgggcggcgagatctggaccatgctgcgggaccgcggctccttc
gaggacaacgccgcccagttcatcatcggctgtgtgctgcaggccttcgagtacctgcac
gcccgcggcatcatctaccgcgacctcaagcccgagaacctgatgctggacgagcgcggc
tacgtgaagctggtggactttggcttcgccaagcacataggcaccagcgccaagacgtgg
accttctgcggcacgcccgagtacgtggcgcccgagatcatcctcaacaagggccacgat
cgcgccgtcgactactgggccctgggcatcctgatcaacgagctgttgaacggaacgccg
ccgttcagtgcctcggatcccatgcagacgtacaacctcatcctcaagggcatcgacatg
atcgacttccccaagcacatctcccgctgggccgtgcagctgatcaagcgcctctgccgc
gacgttccctcggagcgactgggctaccagacgggcggcatacaggacatcaagaagcac
aagtggttcctgggcttcgactgggatgggctggccagccagctgctgattccgcccttc
gtgaggcccatcgcccatgccacggacgtgcgctacttcgatcgcttcccctgcgacccc
gtcgagccgccggacgagctctccggctgggatgccgacttctag

DBGET integrated database retrieval system