KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17448Help
Entry
Dpse_GA17448      CDS       T01032                                 

Definition
GA17448 gene product from transcript GA17448-RA (EC:3.1.2.15 3.4.19.-)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 324 aa AA seqDB search
MSEGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDKEDIFFAKQVINNACATQAILSLLMNLEHEDIKLGETLANFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARQTLFELDMKNQSKDEDLYHFVGYIPIKGRLYELDGLR
EGPIDLGEIKPDQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEKQIDKLLNP
APDAMDTEEDRQTEISSLRSYIQYEVQKKKRYKVENVRRKHNYLPFIVELLKMLGETGQL
MPIYEKAKQRALEREQAQRKKESN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaggtgctggcaactggtgtctcattgagagcgatccgggcgtgttcacggag
ctgattcgcgaatttggttgcgatggcgctcaggtggaggaaatatggagcctggacagt
gaatcgttcaagaacctggagcccatacacggattgatatttctcttcaaatgggtgcag
gaggacgagcccgctggcaaggtggtgctggacaaggaagatatattctttgccaagcaa
gtgatcaacaatgcctgcgccacgcaggccattctcagtttgctgatgaacctggaacac
gaggacatcaaactgggcgagacgctggccaacttcaaggaattttgtcagtgcttcgat
ccctacaacaagggcctgacgttgagcaatgcctcccagatacgcacagtgcacaactcc
ttcgcccggcagactctcttcgagctggacatgaagaaccagagcaaggacgaggatctc
taccactttgtgggatatatccctattaaaggacgtttgtatgagcttgatggcctccgc
gagggacccatcgatcttggtgagatcaagccggatcaaaactggattgatgtggtgcga
ccaatcattgagaagcgcatgcaacgctacagcgacggtgagatccactttaacctgatg
gccctgatctcggaccgtcagcgcatctacgagaagcagatagacaagctgctcaatccg
gctcccgatgccatggatacagaggaagatcgtcagactgaaattagcagcttgcgctcc
tacatccagtacgaggtccagaagaaaaagcgctacaaggtggagaacgtgcgtcgcaaa
cataactacttgcccttcatcgtggagctgctgaaaatgctgggcgagaccggccagctg
atgcccatctacgagaaggccaagcagcgcgcgctggaacgcgaacaggcgcaacgcaaa
aaggagtccaactaa

DBGET integrated database retrieval system