KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17724Help
Entry
Dpse_GA17724      CDS       T01032                                 

Definition
GA17724 gene product from transcript GA17724-RA
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dpse_GA17724
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dpse_GA17724
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     Dpse_GA17724
    3.1.1.84  cocaine esterase
     Dpse_GA17724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 581 aa AA seqDB search
MPCPLLLHLLLLLAIGSSFAQDPPVVELSLGRVQGSTMQSFQGKTIYAFRGIPYAQPPVG
QLRFAAPQAATGWGQEEVLKATSDSLVCPQPGISLLMSEDCLKVNVFTRNLDPEGEPLLL
PVIVYIHGGANVLGSGHSLYEAGPQYLLDHEVVFVAFNYRLGALGFLRPLGSTVTGNFGY
LDQVMALQWVRDHIARFGGDPENVTLFGMSAGSMAVSLHLASPLSRGLFHRAILMSGSAT
NHFAIDNVYWTQKLAREVGCPMYEAADVVQCLRDVAWTRIVEVCKAWESYQFVNMKWNYE
IDGHFLPRHPTELLAEGNFSQVPLLVSFTANELDYTANVHLENDPLLHDLGSSFEEYAPE
LFLYQPDSSISRRLKDFYLGSNVSEISAHNIERFGSIFSDGIIGHGIHRLVHLARRFTPV
YYMRTDYVGKRSLSAPTDDQELPLGVGHADDLQYVMPSLWYGTIMAENHTDLFMMERLTK
WFAHFARTGTPLSSAEEHDYWPPCNATDTAMLYNDVATEVGPPGYPERYAVWDELFPTPA
LGGGVARRQQQLNIVALVAIAWATGVASGLWLFGSAALDGN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgccttgcccactcctactccacctcctactcctgctggccatcgggtcctccttcgcc
caagatccgcctgtggtagagctctccctggggcgcgttcagggctctacgatgcagagt
ttccagggaaagacgatctacgccttccgcggcataccctacgcccagcccccagtgggg
cagctgcgcttcgccgctccccaggcagccactggctgggggcaggaggaggtcctcaag
gccacctctgattctctcgtgtgcccacagcccgggatttcgctgctgatgagcgaggac
tgcctcaaggtgaatgttttcacgaggaacctggaccccgagggggaacctctgctgctg
ccggtgatcgtgtacatccatgggggggccaatgtcctgggcagcggccacagcctgtac
gaggcggggccgcagtatctgctggaccacgaggtggtcttcgtggccttcaactatcgc
ctgggggccctgggcttcctgcggcctctgggcagcactgtgacagggaacttcggatac
ttggaccaagtgatggccctgcagtgggtgcgggaccacatcgcccgcttcgggggagac
ccggagaacgtcacgctcttcgggatgagtgccggatccatggcggtgagcctccacctg
gcatcgcccctctcccgcggcctcttccatcgggccatcctcatgagtggctccgccacg
aatcactttgccatcgacaatgtctactggacgcagaaactggcccgagaagtcggctgc
cccatgtacgaggccgcggatgtggtgcagtgtctgcgcgacgtggcctggactcggatc
gtggaggtctgcaaggcctgggagtcctaccagttcgtgaatatgaagtggaactacgag
atcgatggccacttcctgcccagacatcccacggagctcctggcggagggaaacttcagc
caagtgccgctcctcgtgagttttacggccaacgaattggactacacggcaaatgttcat
ttggagaacgatcctctgctgcacgatttggggtccagtttcgaggagtacgcccccgaa
ttgttcctctaccagcccgactcctccatcagtcgccgcctcaaggacttctatctgggg
agcaacgtctcggagatctccgcgcacaacatcgagcgattcggaagcatcttctccgat
ggcatcattggccatggcatccaccggttggtccatctggccaggcgcttcacccccgtc
tactacatgcgaacggattacgtgggaaagcgcagcctctcggctccgacggacgaccag
gagctgcccctgggcgtggggcatgcggacgatctgcagtacgtgatgcccagcctctgg
tacggcaccatcatggctgagaatcacacggacctcttcatgatggagcgtttgaccaaa
tggtttgcgcactttgctcgaacaggcacacctctatcctcggcggaggagcacgattat
tggccgccctgcaatgccaccgatacggctatgctctacaacgatgtggcgacagaggtg
ggtccgcctggctatcccgaacgatatgccgtctgggacgagctctttcccacgcccgcc
ctgggcgggggcgtggcccggaggcagcagcagctaaacatcgtcgccctcgtggccatc
gcctgggccactggtgtggcctccgggctgtggctcttcggctctgcggctctcgatgga
aattaa

DBGET integrated database retrieval system