KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17827Help
Entry
Dpse_GA17827      CDS       T01032                                 

Definition
GA17827 gene product from transcript GA17827-RA (EC:5.4.99.18 6.3.2.6)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dpse_GA17827
Enzymes [BR:dpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dpse_GA17827
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dpse_GA17827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 426 aa AA seqDB search
MTTTSIEGYKLGKVLIEGKTKQVYDLPEHPGLCLLLSKDRITAGDGVKAHDLAGKAEISN
TTNGQVFRLLNEAGIRTAYVKHCGAKAFIARKCEMIPIEWVTRRLATGSFLKRNVGVPEG
YRFSPPKQETFFKDDANHDPQWSEEQIISAKFELNGLPIGQDEVDIMRRTTLLVFEILER
AWQTKNCALIDMKVEFGIDADGNIVLADIIDSDSWRLWPSGDKRLMVDKQVYRNLTSVTS
SDLDTVKRNFIWVSEQLADIVPRKDHLVVVLMGSASDTSHSEKIATSCRSLGLNVELRVS
SAHKGPEETLRIVREYESVMNNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNMQV
DVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMIWSRLRVKGLNNFITLKKADKEL
RGVRSA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacaactacatccattgagggctacaagcttggcaaggttctgatcgaggggaagacc
aagcaggtgtacgacctgcccgagcatcccggactgtgcctactgctgagcaaggatcgc
atcactgccggcgatggtgtcaaggcgcatgatttggccggcaaggcggagatctcgaac
accaccaacggccaggtctttcgcctgctcaacgaggctggtatacgcactgcctatgtg
aagcattgcggggcgaaggcctttattgcccgcaaatgcgagatgatacccatcgagtgg
gtaactcgacgcctggccactggatcgttcctcaagcgcaatgtcggcgtgccggagggc
tacagattctcaccacccaaacaggagaccttcttcaaggatgacgccaaccatgatccc
cagtggagcgaggagcagataatctcggccaaattcgagctcaatggcctgccaattggc
caggacgaggtggacattatgcggcggacgactctgctggttttcgagatactggagcgg
gcctggcagacaaagaactgtgcgctgatcgacatgaaggtggagttcggcatcgatgcc
gatggcaacattgtgctggccgacattatagactcggactcgtggcgcctctggccgtcg
ggcgacaagcgcctgatggtcgacaagcaggtgtaccgcaacctcacatcggtcacgtcc
agtgacctcgacacggttaagcgcaactttatctgggtgtcggagcagctggcggatatt
gtgccgcgcaaggaccacctggtggtggtgctcatgggcagcgcctcggacacctcgcac
agcgagaagatcgccaccagctgccgctctctgggcctcaacgtagagctgcgcgtcagc
tcagcccacaagggaccggaagagacgcttcgcatcgtccgcgagtacgagtcggtgatg
aacaaccttatctttgtggccgtagccgggcgctccaatggactgggcccggtggtatcg
ggcagcaccaactatccggtgatcaactgcccgcccgtcaagtccgacaacatgcaggtc
gatgtctggtccagcctgaatctgccctcgggcctcggctgtgccaccgttctctatccg
gaggcggcggccctacatgccgccaccattctgggcctgggcaacttcatgatctggtcc
agactgcgggtcaagggcctcaataacttcatcaccctcaagaaggccgacaaggagctg
cgcggtgttcgcagtgcctaa

DBGET integrated database retrieval system