KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17962Help
Entry
Dpse_GA17962      CDS       T01032                                 

Definition
GA17962 gene product from transcript GA17962-RA (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dpse_GA17962
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA17962
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dpse_GA17962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 810 aa AA seqDB search
MSGGPSVTLKSQPIDGSNSGNAAAQQQQQSANGAASSANQGQGSNTNGSAGVSGGAPAQE
GTRQNSLQRIQQRKQKVFNLPLPQKVAKLSMYSACQAEGCRCTGWKTPQENRHRDVESSY
CPEFNEECRNSSCRHSLRTHIAHLDNITSSSMDELLGAIIDMENLFMSMQRVEDEDTKKV
YLYLFRLLRQCVLTRQQAVIRGPLGDPPFESPCITKAVLSLVFYKYQHLNPTELQTMTEV
AKTFLNFLNHYNFESPSTRRGELAHEDASNYKINYTRWLVFCHVPAFCNSLRQFETSLVF
GRTLLRTVFQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRAELLKDDSPIWDPN
YRPPNSFVIQQRKRNQEAAAPPAPGGGAAAIGSNKRSSVGEPLHKRPKKETLERPISENL
DDLPTDVVMRAMKSVSESKTTNKSEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPV
DKQTILWLFGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKESQPIGGICFRPFPSQG
FTEIVFCAVTMAEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIK
LARPVYAGYIKEYDSATLMHCELHPTIVNTQFIAVIRNQSEILKELIAQRHNEVQKVRAG
LTCFKEGVRSIPVESIPGLMEIGWKPQMRPARSARPLEESSDPEKLATSFASVLQSVRQH
TTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFY
NSPETEYYRCANSLERYFQTKMRELGLWDK
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccctcagtaacgctaaaaagtcaaccaattgatgggagtaacagcgga
aatgctgcagcgcaacagcagcagcaatctgcgaatggcgcagcgtcttcagcgaaccag
ggccaaggcagcaacaccaatggtagcgctggggtaagcggcggtgcgcccgcacaagag
ggcacccgccagaacagcttgcagcgcatccagcagcgaaagcaaaaggtattcaacctg
cccctgccccagaaggtggccaagctgtcgatgtactcggcctgccaggctgaaggctgc
cgttgcaccggatggaaaacacctcaggagaacaggcatcgtgatgtggagtcgtcttac
tgtccagaattcaacgaggaatgtcgcaactccagctgccgtcattccctgcgaacgcac
atcgcccacttggacaatataaccagctccagcatggacgagcttctgggtgccattatt
gatatggaaaatctgttcatgtccatgcagcgagtggaagatgaggataccaaaaaggta
tatttgtatctgttccgcctgttgcgtcagtgcgtcctgacgcgccagcaagctgtcatt
cgtggccctttgggtgatcccccgttcgagtcgccatgcattacaaaggcagttttgtcc
ctggtcttctacaaataccagcacctcaacccgactgagctacaaacaatgactgaggtg
gcaaaaacgtttttaaactttctcaaccactacaatttcgagtcgccttcaacgaggcgc
ggcgaactagcccatgaggatgcgtccaactataagatcaactatacccgctggcttgtc
ttctgtcatgttcctgctttttgcaattctttgcgccagttcgagacctcgctggtgttc
ggacgcacccttctgcgcaccgtgttccagtacatgtcgcagcagctaaagaagaagtgc
atttcggaacgagatcgctttccggaagacaagcggtccattataacgcaaatgccaaag
tttcttgaggcgctgcgagcagagcttttgaaagatgactcccccatatgggatcccaac
tatcgtccacccaattcatttgtcatccagcaacggaagcgcaatcaggaagcggcggca
ccaccagcacctggtggcggtgcagctgccattggcagcaataaacgctcaagcgtgggg
gaaccacttcacaagagacccaaaaaggaaacgctcgagcgccccatcagtgagaacttg
gacgatcttcctacagatgtggtaatgcgtgccatgaaatcggtgtccgagtcgaaaaca
acaaacaagtcggaaattctcttcccggtcaatgtgtcacgggatgagaacgtcaaggcc
gaggagcagaagcgcgccattgagttccatgtggtgggcaactccctaacgaagccagtg
gataagcagacaatcctgtggctcttcggtctgcagcttgtctttgcctaccaactcccc
gaaatgccccgcgagtatataagccagctagtgtttgacacaaagcacaaaacccttgcc
ctcatcaaggaaagccagccaatcgggggcatatgcttccgtccgtttccatcgcaggga
ttcacagaaatcgtgttctgtgccgtcaccatggcggagcaggttaagggttatggcacc
catttgatgaaccatctgaaggattacagtattcagcgcggtattaagcatctgctcaca
tttgccgattgcgatgccatcggatattttaagaagcaagggttctccaaggacattaag
ctggctcgtcccgtctatgccggctatataaaggaatacgatagcgccactttgatgcac
tgcgagctgcatccaaccattgtaaacacgcagtttattgcggtgatcagaaatcaaagc
gaaattctgaaagagctcattgctcagcgacacaatgaagtgcagaaagttagagctggt
ttaacttgctttaaggaaggggttcggtctataccggtcgagtccattcctggcctcatg
gaaatcggttggaagccacaaatgcgcccagctcgatcggcccgacccttggaggaatcg
tcggatccagagaaactggccacatcattcgcgtctgtccttcaatcagtccgccagcat
accacggcctggccctttttgcgtccagtgactgctgcggaagtgcccgactattacgac
cacatcaagtatcccatggacttgaagacgatgggcgaacgtttaaagaagggttactat
caaacacgtcgcctgttcatggcagacatggcacgcattttctcaaactgtcgcttttac
aactcccccgaaaccgagtactatcgctgtgccaattcgttggagcgctattttcaaacg
aaaatgcgcgaactgggactgtgggacaaatga

DBGET integrated database retrieval system