KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA17984Help
Entry
Dpse_GA17984      CDS       T01032                                 

Definition
(RefSeq) GA17984 gene product from transcript GA17984-RB (EC:2.7.1.-)
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Longevity regulating pathway - multiple species
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dpse_GA17984
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dpse_GA17984
   04070 Phosphatidylinositol signaling system
    Dpse_GA17984
   04150 mTOR signaling pathway
    Dpse_GA17984
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dpse_GA17984
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dpse_GA17984
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dpse_GA17984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 1112 aa AA seqDB search
MHLVEIGATMNRTASVSHNYAACLLDNRQASYADLTYPGCDMPPTEYAPSDMRFSINLWK
NDPPDYVDLICMIPNGTLLMMKAPSSTTIREIKVEVVKMAKQNCLGYMIKDACDYQFYGI
SVFNIEPYTDETKRLCEVQPHFGLLSLGDRTDATSFSSDYELTKMVSGMIGNSFDHHRTQ
GTPEIDDFRRSMTDLCESIEVERSQFTWQQRLLYEHPLRLAGSVDMPELIRQRHPTSAFL
IVVKNENDQSTFTLSVMEKDTPFSLIESTLQKMNRSQMKMNDRAGDYILKVSGRDEYLFG
DHPLIQFLYIQEALSDSAVPNVVLQSVIRMESYINHHNEQSMGLKRAPKKDRSVVLHKAP
TSLWDLGNYFQLTLHSISNVNYDKTRAFRVGVDVGLYHGEHKLCSQRSIDAPNGSSDTFL
FNDQIMDFDIQMRNLPRMTRLCIVIFEVTKLSRSKKSSNNKDNAQKDVSYNKNPLAWVNT
TLLDYKAHLRTGRQVLYTWTYADDIQSDEVFHPLGTIEPNPRKEECALVHVTFHSSGAES
VRYPCENTVLQYAADRALASLREKQQQPAEPEKPLKDLKELVANYTGLDKIYEMVDQDRN
AIWERRNDILRELPEQLPILLHCVYWKERDDVADIWYLLKRWPLISVERSLELLDYAYPD
PAVRRFAIKCLQILKDDDLLLYLLQLVQAIKHESYLESDLVVLLLERALRNQRIGHYFFW
HLRSEMQTPSMQTRFGLLLEVYLKGCKHHVAPLRKQLQVLDKLKHVSVLAKKGSKEKVKT
MLQDFLGDQRKTGVFQNIQNPLNPSFRCTDVSPDQCKVMDSKMRPLWVVFENADLNSNDV
YIIFKNGDDLRQDMLTLQMLRVMDKLWKRDGMDFRMNIYNCISMEQRLGMIEVVRHAETI
ANIQKEKGMFSATSPFKKGSLYSWLKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVAD
RHSDNIMVKRNGQLFHIDFGHILGHFKEKFGVRRERVPFVLTHDFVYVINKGCNDREAKE
FCHFQELCERAFLTLRKHGCLILSLFSMMISTGLPELSSEKDLNYLRDTLVLDYTEEKAR
EHFRAKFSEALANSWKTSLNWASHNFSKNNKQ
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgcacctggttgagatcggagcaacgatgaaccgcaccgcctccgtttcccacaattat
gctgcctgtttgctggacaaccggcaagcgtcctatgcagacctcacgtacccaggctgc
gacatgcccccgaccgagtacgccccatccgacatgagattctctatcaatctgtggaag
aacgatccgcccgactatgtcgatctcatatgcatgatcccgaatggcaccctgctgatg
atgaaggccccctcgtcgaccacgatacgggaaatcaaggtggaggtcgtcaagatggcg
aaacagaactgcctgggctatatgatcaaggatgcgtgcgactatcagttctacggaatc
tctgtgttcaacatcgaaccctacacggacgagacgaagcgcctgtgcgaggtgcagccc
cactttggtctactcagcctgggcgaccgcaccgatgccaccagcttctccagcgactac
gaactaacgaagatggtcagcggcatgattggcaactcattcgatcatcaccgaacccaa
ggcacgcccgagatcgacgactttcgacgcagcatgacagatctctgcgagagcatcgag
gtggagcgttcccagttcacgtggcagcagcgtctcctctatgagcatcccctgaggctg
gccggctcggtggatatgcccgagctaatacgtcagcgtcatccaacatccgcttttctg
atagtcgtaaagaacgagaacgatcagagcacgttcacgctgtctgtcatggagaaggat
accccgttctcgctgatcgagagcacattgcagaagatgaaccgatcgcagatgaagatg
aacgatcgcgccggcgactatatactgaaagtgagcggccgcgatgagtatctgttcggc
gatcatccgctgatacagttcctgtacatccaagaagcactctcggactcggccgtgccc
aatgtggtgctgcagtcggtgatccgcatggagtcgtacatcaatcaccacaacgagcag
agcatgggcctgaagcgagcccccaagaaggaccggtccgtggtgctccataaggcaccc
acatcgctgtgggatttgggcaactactttcagctgacgctgcacagcatcagcaacgtc
aactacgacaagacacgggcgttccgggtgggcgttgatgtggggctgtatcatggcgag
cacaagctgtgctcgcagcgatcgatagatgcgcccaatggcagctcggacacgttcctc
ttcaacgatcagatcatggactttgacatacagatgcgcaatctcccgcggatgacgcga
ttgtgcatcgtcatctttgaggtgaccaaattgtcgcgctccaagaagtcatccaacaac
aaggacaacgcccagaaggacgtgtcgtacaacaagaatcccctggcctgggtcaataca
acgcttctggactacaaggctcatttgcgaactggccgacaggtgctgtacacgtggaca
tatgcggacgatatacagtcggacgaggtgttccacccgctgggcaccatcgaaccgaat
ccgcgcaaggaggagtgcgccctggtgcacgtaacattccacagcagtggcgccgaatcc
gtgcgctatccctgcgagaatactgtcttgcaatatgcagcggatcgagcgctggccagc
ctccgcgagaagcaacagcagccggcagagcccgagaaaccactgaaagacctcaaggag
ttggtggccaactacaccggcctggacaagatctatgagatggtggaccaggatcgcaat
gccatttgggagcgcaggaatgatatcctccgcgaattgccagaacagctgccgatcctc
ttgcactgtgtgtactggaaggagcgcgacgatgtggccgacatctggtacctcctcaag
cggtggccgctcatctcggttgaacgatcactggaactgctggactatgcctatccggat
ccagccgttcgtcgatttgccatcaagtgtctacaaattctcaaggatgatgatctgcta
ttgtacttgctccaactggtgcaggccatcaagcacgaatcgtatctggagagtgatctg
gttgtgttactgctggagcgagcgctgcgcaatcaacgcatcggccactacttcttctgg
catctgcgatccgagatgcaaacgccttcgatgcagacacggttcggcctcctgctggag
gtctatctcaagggctgtaagcatcatgtggcgccgctgcggaaacagctgcaggtgctc
gacaaactgaagcacgtctctgttttagccaagaagggcagcaaggaaaaggtgaaaacc
atgctgcaggactttctgggggatcagcggaaaacgggcgtcttccagaacatacagaac
ccactgaatcccagctttcggtgtaccgacgtctcgcctgaccagtgcaaggtgatggac
agtaagatgcgtccgctgtgggtggtgttcgagaatgccgatctgaactcgaacgatgtg
tacattatattcaaaaatggcgatgatctgcgccaggacatgctcacactgcagatgctg
cgggtgatggacaagttgtggaaacgagacggcatggactttcgcatgaacatctacaac
tgcatcagcatggagcagcgcctgggcatgattgaagtggtgcggcatgcggagacgatt
gccaacatacagaaggagaaaggcatgttctcggccacatcgccgttcaagaagggctcg
ctgtacagttggctcaaggagcacaacaagcccgctgataagctgaacaaggccatcaac
gagttcacgcttagctgtgccggctactgtgtggccacctatgtactgggcgtggccgat
cgtcattccgacaacataatggtcaagaggaacggacaactctttcacatcgactttgga
cacatcttgggacacttcaaggagaagtttggtgtgcgccgggagcgtgtaccgtttgtg
ctaacccatgattttgtgtacgtcatcaacaagggctgcaatgatcgcgaggcgaaagag
ttttgtcactttcaggaattgtgcgaacgcgcatttttaacattacgcaaacacggctgc
cttatcttatcgctgttctcgatgatgatttcaacaggactgccggaactgtcctccgag
aaggacttgaactatctacgcgacactttggtgctggactatacggaggaaaaagcacgc
gaacatttccgggcgaaattcagcgaagctttggccaactcctggaaaacctctctaaat
tgggcctcgcacaatttctccaagaacaacaaacagtaa

DBGET integrated database retrieval system