KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18000Help
Entry
Dpse_GA18000      CDS       T01032                                 

Definition
GA18000 gene product from transcript GA18000-RA (EC:3.1.2.15)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 1135 aa AA seqDB search
MGKKRQMDNHDNASSTDSGQEDSHGQTIGASGSAGAAGVGSSGADGPMTSYCQHIKKSVD
AARLRRQLKATGLVYECSQCQKNQGAASGSGSGSGDLDCDFEIDSTLWLCLKCGTQLCGR
SRKQHALQHYKTPHSDSHALAMNTRSFEIWCYGCDNKVTPNSRKNLLECVELVKRLAQKP
PAEPPVEAPTVIAVATPSPPTITDIELKFKSALQTLGPIVPMTGGSFEDINSGSSGGNLT
AIPLPAPPGATALTSSSPVRGMATGTDSTAGGPNPPDSPKSEVERLPRVRGLTNLGNTCF
FNAVMQCLAQTPFLLSVLRELSEPGEEFVLPGGKFDFKDKGSTELPIIRGTLSSWGSLTS
ALANALEELQVGGGVFTPRKLFDKLCAKCPQFTGGDQHDAHELLRQLLESVRNEDLKRYQ
RVILQNLGYKDQDSQNVSEEMRRKCKIYGKQAGDRILRPEQVFRGFLVSTLTCQDCHSVS
SRHEYFLDMSLPVAVEKPQPPQRRKPSPESSPFPISGQTQTQNQNQLQLQSPTKINTKFT
TPEDGNPFAADASSSSFYLHANQQETVGPSKSQVKKDKERERKAKRAAKHLRYKQAQKLT
LKLNGNGTGSQADADSEANNELDAADTGTGGGDGDSQTTSDGQGHHKEELISSSSTTSEN
SDADIEDNLVEETATTRDRAKTRGVAGGSSSASSAQGGNSSSSSSRFFTDTNGNAQPLGE
KRDDTPENMDKDSLEEDENDSGIATSPLPSGISKTTTTTTTTTTAANNNEASRSPQQQRE
RRKEDGRSSADIVTAGVSEVGASSIRQISATAATTAAASATAEGVAASAAAAGVAAAAAA
AAAAAAARAKRVRTYSYSDWSTTIAPRYQCEDGECSVQSCLNSFTAVELMTGQNKVGCDS
CTQRLNGNDPKAKSVNTNATKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNML
DIAAFCGSKVKNLPNIDRKQKKLLYALYGVVEHSGGMYGGHYTAYVKVRPKVTPEDKRWK
FLPHGSKAELDQDDDQLKKLEELLAKEKARELHLNSMNDSDDFTNSSSNSSTSEEFNTNP
NGLGPGQKDKQEDEAANVQAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERIY
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagcgtcagatggacaaccacgacaatgccagttcaacggactctggccag
gaggatagccacgggcagacgatcggggccagcggctcggcaggcgctgctggtgttggc
agttcgggggccgatggccccatgaccagctactgccagcacatcaagaaatcggtggat
gcggcccgactgcggcgtcaactgaaggccaccggcctagtctacgagtgttcgcagtgc
caaaagaatcagggcgctgcctccggttcgggatcaggctcaggagacctggactgcgac
tttgagatcgacagcacgctctggctgtgcctcaagtgcggcacccagctttgcgggcgg
tcacgcaagcagcacgccctccagcactataagacaccacactcggactcgcatgcgttg
gccatgaacacaagatcctttgagatatggtgctatggctgcgacaacaaggtcaccccc
aactcccgcaagaacctgctcgagtgcgtcgagctggtgaagcgtctggcccagaagcca
cccgccgaaccgcccgtggaggcccccaccgtcatcgccgtggccacccccagtccgccc
actataaccgacatcgaactgaaatttaaatcggccctgcagacgcttggacccattgtg
cccatgacgggtggctcctttgaggatatcaacagtggcagcagcgggggcaacctaacg
gccatacccctgccggcaccgcccggagccactgccctcaccagcagcagccctgttcga
ggcatggccacggggaccgactccaccgccggcggtccaaatcccccagactcgcccaag
agcgaagttgagcgactgccgcgcgtccgcggactgaccaatttgggcaacacttgcttc
ttcaatgccgtgatgcagtgcctcgcccagaccccgttcctgctcagtgtcctccgcgag
ctgtcggagccaggagaggaattcgtgctgcccggtgggaagttcgacttcaaggacaag
ggctccaccgaactgccgatcatccggggtaccctctcctcctggggtagcctcacatcg
gccttggccaatgccctcgaggagctgcaggtgggtggtggtgtcttcacgccccgcaag
ctcttcgacaagttgtgcgccaagtgtccgcagtttacgggcggggaccagcacgacgcc
cacgagctgctgcggcagttgctggagagtgtgcgtaacgaggatctcaagcgctatcag
cgcgtcatcctgcagaacctcggctacaaggaccaggacagccaaaacgtatcggaggag
atgcggcggaagtgcaagatttacggcaaacaggccggcgaccgcatcctgcgcccggag
caggtcttccgcggcttcctcgtctcgacgctgacctgccaggactgccacagcgtctcg
tcacggcacgagtacttcctggacatgtccctgccggtggctgtcgagaagccccagcca
ccgcagcggcgcaagcccagtcccgagagctcgcccttccccatcagcggccagacgcag
acccagaaccagaaccagttgcagttgcagtccccgaccaaaataaacaccaagttcacg
actcccgaggatggcaaccccttcgcagcggacgcctcctcctcctcgttctacctgcac
gccaaccagcaggagacagtcggtccgtccaagtcgcaggtgaaaaaggataaggagcgc
gagcgcaaggccaagcgggcggcaaaacaccttcgttacaagcaggcccagaagctcacc
ctcaagcttaatgggaacggaacgggcagccaggcagatgccgattccgaggcaaacaat
gagctggatgccgccgatacagggacgggcggcggcgacggggatagccagacgaccagc
gatggccagggtcatcacaaggaggagctaatttcctcgagctccaccacatcggagaat
tcggacgccgatattgaggataatttggtggaggaaacggcaacgaccagggacagggcc
aagaccagaggagtcgccggtggctcatcatccgcttcatccgctcaaggaggcaacagc
agtagcagcagcagcaggtttttcaccgacaccaatgggaacgcccagccgttgggcgag
aagcgggatgacacgccggagaacatggacaaggactccctcgaagaggacgagaacgac
tcaggcatagccactagtccgttgcccagcggcatcagtaaaacgacgacgaccaccacc
actaccaccaccgccgccaacaacaatgaggcctccagaagtccacagcagcagcgggag
cggaggaaggaggacggccgatcatctgcggacatagtcacagcaggcgtgagcgaagtg
ggagcctcctccatacggcaaatctcggccacagcggcaacgacagctgcagcttcggcc
acagccgaaggagtggcagcatcagcagcggcggcaggagtagcggcagctgcggcagct
gcagcagcggcagcagcagcacgcgctaagcgtgtgcgaacgtacagctattcggactgg
agcaccacgatagcgccgcggtaccagtgcgaggacggagagtgctctgttcagtcctgc
ctcaacagcttcactgccgtcgagctgatgaccggccagaacaaggtgggatgcgacagc
tgcacgcagcgtctgaatgggaacgatccgaaggcaaagtcggtcaacacgaacgccacc
aagcagctgctggtgtccagcccgccggcggtgctcatcctacacctgaagcgcttccag
ctgggtccgcgctgcatattccgaaagctgacgcggccggtcagctacccaaacatgctg
gacattgccgccttctgcgggtccaaggttaagaatctgcccaatatcgatcgcaagcag
aagaaactactgtacgctctatacggtgtggtggaacactcgggcggcatgtacggcggt
cactacaccgcctacgtgaaggtgcggcccaaggtgacgccagaggacaaacgctggaag
ttcttgccgcacggcagcaaggccgagctcgaccaggacgacgatcagctgaagaagctg
gaagagttgcttgcgaaggagaaggcgcgggagctgcacttgaactcgatgaacgacagc
gacgacttcaccaactctagcagcaattcatctacctctgaggagttcaataccaacccc
aatggactcggacccggccagaaggataagcaggaggatgaggctgccaatgtccaggca
ccgccaggaaaatggtattacgtatcagactcgcgggttcaggaggttagcgaggacacg
gcgctcaaggcccaggcctatctgctcttctacgagcgcatctactaa

DBGET integrated database retrieval system