KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18001Help
Entry
Dpse_GA18001      CDS       T01032                                 

Definition
(RefSeq) GA18001 gene product from transcript GA18001-RA
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dpse_GA18001
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA18001
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dpse_GA18001
Ubiquitin system [BR:dpo04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dpse_GA18001
Chromosome [BR:dpo03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     Dpse_GA18001
    SLIK complex
     Dpse_GA18001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 723 aa AA seqDB search
MSAVTAALFCKIVDSAVAALTVVPILQHLCVFIAKVAKIRRKQRKSDKAFVPQPCSKRTK
TKENSVDSTTSVISITSSSSSTHSGSVVVAGGLNNTSSNNKRFYPGTGAGRGTAENETAA
EAAADSVAAAKTTTTTKSSAKSAAGRCVATEENETVARSGRGRGVERGKDDKDEATGSES
DGGAKLTKGPLNAAYLSACLRTVQKLAIELDVSVDAKSVASREREASGVMSETGCRHYQS
YLKEHGYDTYRVIDAYFSACVNKDARLKKAIHCYCFECGSASIQLYACLHCIYFGCRGSH
IHSHLRAKKHHVALELSHGTLYCHACRDFIYDSRSREYALINRKLEAKDLQKSLGWQPWI
PSAKDSNLLLANPRRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTPLLSDYFMSDRH
DCGKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYEQQDAHEFFIAT
LDVLHRHCVKAKAEHESKSNSSSSGSGTNSTSSSTSSYGQCNCIIDQIFTGMLQSDVVCQ
ACKGVSTTFDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSAAKIKCSTCKSY
QESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFMSEKKNAYGDFR
FSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSEGYLLFYHKNVL
EYE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctgtcacagcagccctgttttgcaagattgtcgattcagctgtcgccgctctg
accgtagttcctattttacagcacttgtgtgtgttcatagcaaaagtggccaaaattcgg
cgaaaacagcgcaagagtgataaagcattcgtgccgcagccgtgttccaaacgaacgaaa
acaaaagagaatagtgttgatagtactacaagcgtaattagcataacaagcagcagcagc
agcacccacagtggtagcgtcgtcgttgccggcggcctaaacaacaccagcagcaacaac
aaacgattctacccagggacgggagcgggccggggaacggccgaaaacgaaacagcggca
gaagcagcagcagattcagtagcagcagcaaaaacaacaacaacaacaaagtcatcggca
aagtcagctgccggccggtgtgtggcgacagaggaaaacgaaactgttgctagaagtggg
cgtggcagaggtgttgagagggggaaagacgacaaagacgaagcaaccggcagcgagagc
gacggcggagcaaagctgacaaagggcccactgaatgcggcgtatttgtcggcctgtttg
cgcacagtccaaaagcttgctattgaacttgacgtcagcgttgacgccaagagcgtcgct
agcagggagagggaggcgagcggtgtcatgtcggagacaggctgccggcattatcagagc
tacttgaaggagcacggatatgatacataccgggtcatcgatgcttatttttctgcctgc
gtgaacaaagatgcgcgtttgaagaaggccatacactgctactgcttcgagtgcggcagc
gccagcatccagctatacgcctgcctgcactgcatctactttggctgccggggctcacac
atccacagccatctgcgggcaaagaaacaccatgtggccctggagctgtcccatggaacg
ctttactgccatgcgtgtcgcgactttatctacgactcgcgcagccgtgagtacgcgctg
atcaaccggaagctggaggccaaggatctgcagaagagcctggggtggcagccgtggata
ccttcggccaaggactcgaacctgctgctggccaatccacgacgccggctagtgcggccc
aatcagacgatcgggctgaggggactcctcaatctgggggccacctgcttcatgaactgc
attgtccaggccttggtacacaccccactgctgagcgactactttatgtcggaccggcat
gactgcggcaagtcctcgcacaagtgtctggtctgcgaagtgtcgcgtctcttccaggag
ttctattcgggctcccgttcgccgctgtcgctgcatcgcctattgcatttaatctggaac
catgccaagcacctggcaggttacgagcagcaggatgcgcacgagttcttcattgccacg
ctggatgtgctgcatcggcattgcgtcaaggccaaggcggagcacgagagcaagagcaat
agctctagctcgggtagcggcaccaattcaaccagctcctcgacttccagctacggacag
tgcaactgcatcatcgaccagatcttcacgggcatgctgcagagcgacgtggtgtgccag
gcctgcaagggcgtgtccactacattcgatcccttctgggacatttcgctggacctgggc
gagaccacgacgcacggtggtgtaacgcccaagacgttgatcgactgcctggagcggtac
acgcgggccgagcatctaggctccgcggcgaagataaaatgctccacctgcaagtcctac
caggagtccaccaagcagttcagcctacggactctgcccagcgtggtctcttttcatctg
aagcgctttgaacactcggcgctgatcgatcgcaagatctcctcgttcatccagttcccc
gtcgagttcgatatgacgcccttcatgtccgagaagaagaatgcctacggcgactttcgc
ttctccctgtacgcggtggtcaatcacgtgggcaccatcgacactggccactacacggcg
tatgtgcggcatcagaaggacacgtgggtaaagtgtgatgatcatgtgataactatggca
tcgctcaaacaggtgctggacagcgagggctatttattgttttaccataaaaacgtgctg
gaatacgagtag

DBGET integrated database retrieval system