KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18001Help
Entry
Dpse_GA18001      CDS       T01032                                 

Definition
GA18001 gene product from transcript GA18001-RA (EC:3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dpse_GA18001
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dpse_GA18001
Transcription machinery [BR:dpo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dpse_GA18001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 494 aa AA seqDB search
MSETGCRHYQSYLKEHGYDTYRVIDAYFSACVNKDARLKKAIHCYCFECGSASIQLYACL
HCIYFGCRGSHIHSHLRAKKHHVALELSHGTLYCHACRDFIYDSRSREYALINRKLEAKD
LQKSLGWQPWIPSAKDSNLLLANPRRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTP
LLSDYFMSDRHDCGKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGYE
QQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSSSGSGTNSTSSSTSSYGQCNCIIDQIF
TGMLQSDVVCQACKGVSTTFDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLGSA
AKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTPFM
SEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLDSE
GYLLFYHKNVLEYE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagacaggctgccggcattatcagagctacttgaaggagcacggatatgataca
taccgggtcatcgatgcttatttttctgcctgcgtgaacaaagatgcgcgtttgaagaag
gccatacactgctactgcttcgagtgcggcagcgccagcatccagctatacgcctgcctg
cactgcatctactttggctgccggggctcacacatccacagccatctgcgggcaaagaaa
caccatgtggccctggagctgtcccatggaacgctttactgccatgcgtgtcgcgacttt
atctacgactcgcgcagccgtgagtacgcgctgatcaaccggaagctggaggccaaggat
ctgcagaagagcctggggtggcagccgtggataccttcggccaaggactcgaacctgctg
ctggccaatccacgacgccggctagtgcggcccaatcagacgatcgggctgaggggactc
ctcaatctgggggccacctgcttcatgaactgcattgtccaggccttggtacacacccca
ctgctgagcgactactttatgtcggaccggcatgactgcggcaagtcctcgcacaagtgt
ctggtctgcgaagtgtcgcgtctcttccaggagttctattcgggctcccgttcgccgctg
tcgctgcatcgcctattgcatttaatctggaaccatgccaagcacctggcaggttacgag
cagcaggatgcgcacgagttcttcattgccacgctggatgtgctgcatcggcattgcgtc
aaggccaaggcggagcacgagagcaagagcaatagctctagctcgggtagcggcaccaat
tcaaccagctcctcgacttccagctacggacagtgcaactgcatcatcgaccagatcttc
acgggcatgctgcagagcgacgtggtgtgccaggcctgcaagggcgtgtccactacattc
gatcccttctgggacatttcgctggacctgggcgagaccacgacgcacggtggtgtaacg
cccaagacgttgatcgactgcctggagcggtacacgcgggccgagcatctaggctccgcg
gcgaagataaaatgctccacctgcaagtcctaccaggagtccaccaagcagttcagccta
cggactctgcccagcgtggtctcttttcatctgaagcgctttgaacactcggcgctgatc
gatcgcaagatctcctcgttcatccagttccccgtcgagttcgatatgacgcccttcatg
tccgagaagaagaatgcctacggcgactttcgcttctccctgtacgcggtggtcaatcac
gtgggcaccatcgacactggccactacacggcgtatgtgcggcatcagaaggacacgtgg
gtaaagtgtgatgatcatgtgataactatggcatcgctcaaacaggtgctggacagcgag
ggctatttattgttttaccataaaaacgtgctggaatacgagtag

DBGET integrated database retrieval system