KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18067Help
Entry
Dpse_GA18067      CDS       T01032                                 

Definition
GA18067 gene product from transcript GA18067-RA (EC:3.1.2.15)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 227 aa AA seqDB search
MSTWTPLESNPEVLTKYIHKLGVSPAWSVNDVIGLDEDMLDFIPRPVKAFILLFPCSEAY
EKHRAEEHERIKDVKEQHPDDLFYMRQFTHNACGTVALIHSVANNKEVDVTGGVLKKFLE
KTAALSPEERGSALEQDTEFTADHQALAQEGQTNADEHESVIHHFIALVNKDGTLYELDG
RKSFPIKHGKTTEETFVSDAAKVCKEFMARDPTEVRFTVLALTAAQD
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctggacgccacttgaatccaaccccgaggtgctgaccaagtacatacacaag
ctaggcgtgtcgcctgcctggtcggtgaatgacgtcattggtctggacgaagatatgctc
gactttattccccgtccggtgaaggctttcatattgctctttccatgcagcgaggcttat
gagaaacatcgtgctgaggagcatgagcgcatcaaggatgtgaaggagcagcatcctgac
gatctgttctacatgcgccaattcactcacaatgcttgcggcactgtggccctcatccat
agcgtggccaataacaaggaggtggatgtaactgggggagttctgaagaagttcctggag
aaaaccgccgctttgtcgccagaggagcgtggctctgctttggagcaagataccgagttt
acagccgaccatcaggctttggctcaagagggccagaccaatgccgacgagcatgagagt
gtgatccatcattttattgctttggtgaacaaagatggcaccctctacgagctcgatgga
cgcaaatcgtttcccatcaagcatggcaagaccacagaggagacctttgtgagcgatgcg
gccaaggtgtgcaaagagtttatggcccgtgatcccaccgaagtacgtttcacagtcttg
gccttgactgctgcgcaggattag

DBGET integrated database retrieval system