KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18094Help
Entry
Dpse_GA18094      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00040  Pentose and glucuronate interconversions
dpo00053  Ascorbate and aldarate metabolism
dpo00830  Retinol metabolism
dpo00860  Porphyrin and chlorophyll metabolism
dpo00980  Metabolism of xenobiotics by cytochrome P450
dpo00982  Drug metabolism - cytochrome P450
dpo00983  Drug metabolism - other enzymes
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA18094
   00053 Ascorbate and aldarate metabolism
    Dpse_GA18094
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA18094
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA18094
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA18094
   00982 Drug metabolism - cytochrome P450
    Dpse_GA18094
   00983 Drug metabolism - other enzymes
    Dpse_GA18094
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dpse_GA18094
Glycosyltransferases [BR:dpo01003]
 Others
  Hydrophobic molecule
   Dpse_GA18094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C IncA Prominin Glyco_transf_4 TMIE
Motif
Other DBs
NCBI-GeneID: 4803762
NCBI-ProteinID: XP_001360427
FlyBase: FBgn0078102
UniProt: Q291W1
Position
3
AA seq 527 aa AA seqDB search
MQLKCILLLTLVALQQLCLGEGSRILAAFFFPGKSHFMMTNAIVRELVKRGHEVTFITPF
SLAKENLGPNYKEVLIAQYDFWPEIKEMTKTSTILEMTDVPNLTFVRLMTVMGAHSTDFA
FDQPEIQEIVNVKDKVGKYDLLLAEQFFNEGALILGHLYQIPIITVSTFGYANYLSQLAG
IVSPWSYVPHAFMPYTDRMTLWERIGNVAISGTEDLIREFSYYPKHDAILKKHFSGLLDR
VPTIKELERNISAILLNNYMPLTTTRPTSFNMIPVGGLHIQPPKPLPQHLQQFLDGATDG
VIYFSLGSQVRSADLPPEKLKIFLNVFGSLKQRVLWKFEDESLPNLPANVKVQNWLPQGD
ILAHPNVKVFIAHGGLFGTQEAVYNGVPMLGMPVYCDQHLNINQGKQAGYALGLDYRTVS
EDQLRSSLTELLQNPKYRTKMQQASRIFRDRPLSAMDTAMYWIEYVIEHRGAPHLVASGV
DLPWYQFYLLDIVALALAIVLLPIVALCCLCRSSKPKRESRKKAKRN
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaaatgtatcctgctcctcacgctggtagctcttcagcagctgtgcctgggc
gaggggtcccgcatcctggcggccttcttctttcccggaaaaagccacttcatgatgacg
aacgccattgttcgggagctggtgaaacgcggacacgaagtcacctttatcacgcctttc
tccctagcgaaggagaacctgggacctaactacaaggaggtgctgattgcgcagtacgat
ttctggccagaaattaaggagatgaccaaaaccagtaccattttggagatgaccgatgtg
ccaaacctgacgttcgtcaggctgatgacggtgatgggtgcccacagcacggactttgcc
ttcgaccagccggagatacaggagatagtgaatgtcaaggacaaagtcgggaagtacgat
ctgctgctggcggagcagttctttaacgagggcgccctcattctggggcatctctaccag
atccccatcatcaccgtctcgaccttcgggtacgccaactacctcagccagctggcgggc
atcgtctcgccctggtcctatgtgccccatgctttcatgccctacacggaccgcatgacg
ctgtgggagcgcatcgggaatgtggccatctctggaaccgaagatctcatcagggagttc
tcctactatcccaagcacgatgcgattctgaagaagcacttctccggactgctggacagg
gtaccgaccatcaaggaactggagcggaacatatccgccatcctgctgaacaactacatg
ccgctgaccacgaccagacccacctccttcaacatgattcctgtggggggactgcacatt
cagccaccaaaaccgttgccccagcatctgcagcagttcctcgatggggccaccgacgga
gtcatctacttcagtctgggttcccaggttcgcagtgccgatctcccgcccgagaagcta
aagatcttcctcaacgtcttcggaagcctcaagcagcgggttctgtggaagttcgaggat
gagtcgctgcccaatctgccggccaacgtgaaggtgcaaaactggctgccgcagggggat
atcctagcacatcccaatgtcaaggtcttcatcgcccacggcggactcttcggcacgcag
gaagcagtttacaacggggtcccgatgctgggaatgcccgtctattgcgaccagcatctg
aacatcaaccaaggcaaacaggccggctatgcgctgggcctggactatcgcactgtctcc
gaggatcagctgcgatcctcgctcactgaactcctccagaatcccaagtatagaaccaaa
atgcaacaggcctcgcgaatcttcagggatcgccctctgagtgcaatggacactgccatg
tactggatagagtacgtgatcgagcatcgcggagctccgcatctggtggcatctggcgta
gatctgccctggtaccagttctacctcctggacatcgtagccctggccctggccatcgtt
ctcctgcccatcgtggccctctgctgtctgtgccgcagctccaaaccgaagagggagtca
aggaagaaggccaagcgcaactaa

DBGET integrated database retrieval system