KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18094Help
Entry
Dpse_GA18094      CDS       T01032                                 

Definition
GA18094 gene product from transcript GA18094-RA (EC:2.4.1.-)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA18094
   00053 Ascorbate and aldarate metabolism
    Dpse_GA18094
   00500 Starch and sucrose metabolism
    Dpse_GA18094
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dpse_GA18094
   00860 Porphyrin and chlorophyll metabolism
    Dpse_GA18094
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dpse_GA18094
   00982 Drug metabolism - cytochrome P450
    Dpse_GA18094
   00983 Drug metabolism - other enzymes
    Dpse_GA18094
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dpse_GA18094
Glycosyltransferases [BR:dpo01003]
 Others
  Hydrophobic molecule
   Dpse_GA18094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 528 aa AA seqDB search
MVQLKCILLLTLVALQQLCLGEGSRILAAFFFPGKSHFMMTNAIVRELVKRGHEVTFITP
FSLAKENLGPNYKEVLIAQYDFWPEIKEMTKTSTILEMTDVPNLTFVRLMTVMGAHSTDF
AFDQPEIQEIVNVKDKVGKYDLLLAEQFFNEGALILGHLYQIPIITVSTFGYANYLSQLA
GIVSPWSYVPHAFMPYTDRMTLWERIGNVAISGTEDLIREFSYYPKHDAILKKHFSGLLD
RVPTIKELERNISAILLNNYMPLTTTRPTSFNMIPVGGLHIQPPKPLPQHLQQFLDGATD
GVIYFSLGSQVRSADLPPEKLKIFLNVFGSLKQRVLWKFEDESLPNLPANVKVQNWLPQG
DILAHPNVKVFIAHGGLFGTQEAVYNGVPMLGMPVYCDQHLNINQGKQAGYALGLDYRTV
SEDQLRSSLTELLQNPKYRTKMQQASRIFRDRPLSAMDTAMYWIEYVIEHRGAPHLVASG
VDLPWYQFYLLDIVALALAIVLLPIVALCCLCRSSKPKRESRKKAKRN
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggttcaactgaaatgtatcctgctcctcacgctggtagctcttcagcagctgtgcctg
ggcgaggggtcccgcatcctggcggccttcttctttcccggaaaaagccacttcatgatg
acgaacgccattgttcgggagctggtgaaacgcggacacgaagtcacctttatcacgcct
ttctccctagcgaaggagaacctgggacctaactacaaggaggtgctgattgcgcagtac
gatttctggccagaaattaaggagatgaccaaaaccagtaccattttggagatgaccgat
gtgccaaacctgacgttcgtcaggctgatgacggtgatgggtgcccacagcacggacttt
gccttcgaccagccggagatacaggagatagtgaatgtcaaggacaaagtcgggaagtac
gatctgctgctggcggagcagttctttaacgagggcgccctcattctggggcatctctac
cagatccccatcatcaccgtctcgaccttcgggtacgccaactacctcagccagctggcg
ggcatcgtctcgccctggtcctatgtgccccatgctttcatgccctacacggaccgcatg
acgctgtgggagcgcatcgggaatgtggccatctctggaaccgaagatctcatcagggag
ttctcctactatcccaagcacgatgcgattctgaagaagcacttctccggactgctggac
agggtaccgaccatcaaggaactggagcggaacatatccgccatcctgctgaacaactac
atgccgctgaccacgaccagacccacctccttcaacatgattcctgtggggggactgcac
attcagccaccaaaaccgttgccccagcatctgcagcagttcctcgatggggccaccgac
ggagtcatctacttcagtctgggttcccaggttcgcagtgccgatctcccgcccgagaag
ctaaagatcttcctcaacgtcttcggaagcctcaagcagcgggttctgtggaagttcgag
gatgagtcgctgcccaatctgccggccaacgtgaaggtgcaaaactggctgccgcagggg
gatatcctagcacatcccaatgtcaaggtcttcatcgcccacggcggactcttcggcacg
caggaagcagtttacaacggggtcccgatgctgggaatgcccgtctattgcgaccagcat
ctgaacatcaaccaaggcaaacaggccggctatgcgctgggcctggactatcgcactgtc
tccgaggatcagctgcgatcctcgctcactgaactcctccagaatcccaagtatagaacc
aaaatgcaacaggcctcgcgaatcttcagggatcgccctctgagtgcaatggacactgcc
atgtactggatagagtacgtgatcgagcatcgcggagctccgcatctggtggcatctggc
gtagatctgccctggtaccagttctacctcctggacatcgtagccctggccctggccatc
gttctcctgcccatcgtggccctctgctgtctgtgccgcagctccaaaccgaagagggag
tcaaggaagaaggccaagcgcaactaa

DBGET integrated database retrieval system