KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18105Help
Entry
Dpse_GA18105      CDS       T01032                                 

Definition
(RefSeq) GA18105 gene product from transcript GA18105-RB (EC:3.1.3.2)
  KO
K03103  
multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycolysis / Gluconeogenesis
Inositol phosphate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dpse_GA18105
   00562 Inositol phosphate metabolism
    Dpse_GA18105
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     Dpse_GA18105
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     Dpse_GA18105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 461 aa AA seqDB search
MLQPFPILFLPLLLSALVLVLPLERAVLADADTQAAAACSSLQRADIERRLSTKTPYRVI
ANYDETPPQYAGCHPTRIWSVIRHGSRNPSKKVILRAQQRLVELQQRLLSQPHPNLCPAE
MKQLREWSWGHLNAAEDEKLLVAEGEDELIELAERMQLRFPSLLPDMYDPAWYYMKYTDT
QRTLKSAQSFATGLFGRHRIHAVRYPRPVYRDPVLRFYKLCDRWRTDVDKNPETFINARR
FTEEPEMQSAVEHVRGSTQLPDLGPEDVELMYMVCAFETSWQRRRQRESVWCSFFDVDAL
RALEFAKDLEYYWNDGYGYELTHRIACPAIADMFSAIDPVSQAMPRANATFYFTHSGTLL
KLLAHLGLAKDKEALTHKHFGSDRLWRTSEIDAFATNLAFLRYECEQGPPRVLVLHQERA
VRLPGCPQDEDLCPLATIRRLYADSVERCDFEALCQVDDTK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaccattcccaattctgttcctgccacttctgctatcggcactagtactggta
ctgccactggagcgcgcagtattggccgatgccgatacccaggcggcggctgcctgcagc
agcctgcaacgggccgacattgagcggcgcttgtccaccaagacaccctatagggttata
gctaattacgatgagacgccgccgcagtacgcgggctgccaccctactcgaatctggtcg
gtcattcgccatggcagccggaatcccagcaaaaaggtcatattgcgcgcccagcagcgt
ctcgtggagttgcagcagcgcctgctcagccagccacatcctaatctctgcccagccgaa
atgaagcaactccgtgaatggagctgggggcatctgaacgccgccgaggatgagaagctg
ctggtggctgagggcgaggatgagctgatagagctggccgaacgcatgcagttgcgcttt
ccctcgctcttgccggacatgtacgaccccgcctggtattacatgaagtacacggacacc
cagaggacgctgaagagcgcccagagttttgcaacgggtctgtttggccgtcatcgcata
cacgcggtgcgttatccccgacctgtgtatcgggatcctgtgcttaggttctataaactc
tgcgacagatggagaactgacgtcgataagaatcccgaaacttttattaatgcacgccgg
ttcaccgaagagccggagatgcagtcagcagtggagcatgtgcggggcagcacccagctg
ccggacttgggacccgaggatgtggagcttatgtatatggtgtgcgccttcgagacatcc
tggcagcgtcgacggcagcgcgaatcggtctggtgcagcttcttcgatgtggatgccttg
agggccttggagtttgccaaggatctggagtactattggaacgatggctatggctatgag
ctgacccatcgcattgcctgtccggcgatagcagatatgttttcggccatcgacccagtc
tcccaggccatgccccgggccaatgccacgttctacttcacccattcgggtacactgctg
aagctgctggcccatctcggcctggccaaggacaaggaggcactcacacacaagcatttt
ggcagcgatcgtctctggcgcaccagcgaaatcgatgcctttgcgaccaacttggctttt
ctgcgctacgaatgcgagcaggggccgcctcgtgtcctggtgctgcaccaggagcgtgca
gtccgcctgccaggttgcccacaagacgaggacctgtgcccgctggccacgatacgccgc
ctatatgcggacagtgtggagcgctgcgactttgaggccctctgccaagtcgacgacacc
aaatga

DBGET integrated database retrieval system