KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18105Help
Entry
Dpse_GA18105      CDS       T01032                                 

Definition
(RefSeq) GA18105 gene product from transcript GA18105-RB (EC:3.1.3.2)
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XL
AA seq 461 aa AA seqDB search
MLQPFPILFLPLLLSALVLVLPLERAVLADADTQAAAACSSLQRADIERRLSTKTPYRVI
ANYDETPPQYAGCHPTRIWSVIRHGSRNPSKKVILRAQQRLVELQQRLLSQPHPNLCPAE
MKQLREWSWGHLNAAEDEKLLVAEGEDELIELAERMQLRFPSLLPDMYDPAWYYMKYTDT
QRTLKSAQSFATGLFGRHRIHAVRYPRPVYRDPVLRFYKLCDRWRTDVDKNPETFINARR
FTEEPEMQSAVEHVRGSTQLPDLGPEDVELMYMVCAFETSWQRRRQRESVWCSFFDVDAL
RALEFAKDLEYYWNDGYGYELTHRIACPAIADMFSAIDPVSQAMPRANATFYFTHSGTLL
KLLAHLGLAKDKEALTHKHFGSDRLWRTSEIDAFATNLAFLRYECEQGPPRVLVLHQERA
VRLPGCPQDEDLCPLATIRRLYADSVERCDFEALCQVDDTK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaccattcccaattctgttcctgccacttctgctatcggcactagtactggta
ctgccactggagcgcgcagtattggccgatgccgatacccaggcggcggctgcctgcagc
agcctgcaacgggccgacattgagcggcgcttgtccaccaagacaccctatagggttata
gctaattacgatgagacgccgccgcagtacgcgggctgccaccctactcgaatctggtcg
gtcattcgccatggcagccggaatcccagcaaaaaggtcatattgcgcgcccagcagcgt
ctcgtggagttgcagcagcgcctgctcagccagccacatcctaatctctgcccagccgaa
atgaagcaactccgtgaatggagctgggggcatctgaacgccgccgaggatgagaagctg
ctggtggctgagggcgaggatgagctgatagagctggccgaacgcatgcagttgcgcttt
ccctcgctcttgccggacatgtacgaccccgcctggtattacatgaagtacacggacacc
cagaggacgctgaagagcgcccagagttttgcaacgggtctgtttggccgtcatcgcata
cacgcggtgcgttatccccgacctgtgtatcgggatcctgtgcttaggttctataaactc
tgcgacagatggagaactgacgtcgataagaatcccgaaacttttattaatgcacgccgg
ttcaccgaagagccggagatgcagtcagcagtggagcatgtgcggggcagcacccagctg
ccggacttgggacccgaggatgtggagcttatgtatatggtgtgcgccttcgagacatcc
tggcagcgtcgacggcagcgcgaatcggtctggtgcagcttcttcgatgtggatgccttg
agggccttggagtttgccaaggatctggagtactattggaacgatggctatggctatgag
ctgacccatcgcattgcctgtccggcgatagcagatatgttttcggccatcgacccagtc
tcccaggccatgccccgggccaatgccacgttctacttcacccattcgggtacactgctg
aagctgctggcccatctcggcctggccaaggacaaggaggcactcacacacaagcatttt
ggcagcgatcgtctctggcgcaccagcgaaatcgatgcctttgcgaccaacttggctttt
ctgcgctacgaatgcgagcaggggccgcctcgtgtcctggtgctgcaccaggagcgtgca
gtccgcctgccaggttgcccacaagacgaggacctgtgcccgctggccacgatacgccgc
ctatatgcggacagtgtggagcgctgcgactttgaggccctctgccaagtcgacgacacc
aaatga

DBGET integrated database retrieval system