KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18125Help
Entry
Dpse_GA18125      CDS       T01032                                 

Definition
GA18125 gene product from transcript GA18125-RA (EC:2.7.7.-)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dpse_GA18125
   00052 Galactose metabolism
    Dpse_GA18125
   00500 Starch and sucrose metabolism
    Dpse_GA18125
   00520 Amino sugar and nucleotide sugar metabolism
    Dpse_GA18125
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dpse_GA18125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 513 aa AA seqDB search
MLDVPNEGKVRGHQRVPSDSKEFHEVTKRDALRLLENDVDRLLQTTEQVRRPALQAEMGR
FADLFGRFLQEEGPALDWNKIQKLPENAVMNYSNLKLPKNEQNEIRNMLDKLVVIKLNGG
LGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVR
KYKGFRVQIHTFNQSCFPRISREHFLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLK
KFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERASTPVEFVMEVTDKTRADVKGGTLI
QFENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLASIDRVLRERTLSMEIIVNN
KTLETGLRVIQLETAVGSAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSL
VMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGT
VIIIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtgcccaatgaaggaaaggtgcgtggccaccagcgagtgccctccgattcg
aaggagttccatgaggtcaccaagcgggatgctctgcggctgctggagaacgatgtggac
cgtctgctccagacaacagaacaggtgcgtcggccagccctccaggcggagatgggtcgc
tttgccgatctctttggacgcttcctgcaggaggagggtcccgctttggactggaacaag
atccagaagctgccagaaaatgctgtgatgaactattcgaacctaaagttgccaaagaac
gagcagaatgagatacgcaatatgctggacaaattggtggtcattaagctgaacggtggc
ctgggcacttccatgggttgtcatggacccaagagtgtgattcccgtcagatctgatttg
acgtttttggatctgaccgtccagcagatcgagcatctgaacaagacctacgatgccaat
gtgccgctggtgctgatgaactccttcaacaccgatgaggataccgagaagattgttcgg
aaatacaagggcttccgcgtgcagatacacaccttcaatcagagctgctttccgcgcatc
agtcgcgagcattttctgcctgtggccaaggactttgatgtggagaaggatatggaggct
tggtatccacctggtcatggcgacttttacgacactttccgcaactctgggctgctgaag
aagttcatcgaagagggacgcgaatattgtttcctctccaacattgacaatctgggcgcc
accgtggatttgaatatactcaataagctggtgggcgaggagcgggccagcactccagtg
gaatttgtcatggaagtcactgacaagacacgggctgatgtcaagggtggcactctcata
cagttcgagaacaagctgcggctgctggaaattgcccaagtaccgccagagcatgtggat
gactttaaatcggtgaagaccttcaagtttttcaacaccaacaacatttgggccaatcta
gcatccatcgatcgggtcttgcgggagcgcaccttgagtatggagattattgtgaacaac
aaaacgctagaaacgggtctgcgtgtcattcaattggagacagctgtgggttcggccatg
aagtgctttgatggcgcaattggcatcaatgtacctcggtcgcgcttcttgcccgtgaag
aagtcctccgatctgcttttggtcatgtccaatctgtatacgttgaagaacggcagcctg
gtgatgtcgccgcagcgcatgttccccaccacgccactggtgaagctaggcgagaatcac
ttctccaaggtgaaggagtttctgggtcgctttgccaatatacccgacattattgagctg
gatcatttgacggtcagtggagacgtgacctttggccgtggtgtttctttgaggggcact
gtgatcatcattgccaatcatggggatcgtattgatatacccgctggggctatcctagag
aacaagattgtctctggcaatatgcgcattctggaccattaa

DBGET integrated database retrieval system