KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18274Help
Entry
Dpse_GA18274      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2
AA seq 461 aa AA seqDB search
MDLEQELVLVPAPGQLPRPAVQVKVTNEVESAMRMMMMMITATGMRQQTNYFDTQMANRL
PLLSLSNLMSPSSTPTPSPSPRPKLSMLPILDGRSSDISPDTEQLLRLQSSDYKLLYNAE
RHTYFQLHTITGNHRVSNAHKDAAASNRRRLFQQAVGSTLSAAFGLNVMAMDGRAVTTET
VHLYDAASLRQSRFNPFNPTRILIHGWLGNANANIYSALLPPYLSLDKGRYNIFTVDWGR
GAIADYITASYRVKPVGQVLAKFVDFLHQEAGLRFEDLQLVGFSMGAHVAGLAGKHLQTG
RLRMIRALDPALPFFRYAQDKERLAKGDADYVEVLHTSVGSYGFDRPLGHADFYANWGSQ
QPGCFWRECSHWRAFSLFAESLRPGREFPARGCAVSEWQQLTRFHRCPRETGNRQSMGGD
LANASMELLLARRQGVYYFETNAKPPYGMVQRNVSPKGKHK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatctggagcaagagctggtgctggtgccggcaccgggacagctgccaagacccgca
gtgcaagtaaaagtgacaaatgaagtggaaagtgccatgagaatgatgatgatgatgatt
actgcgacgggtatgaggcagcagacgaactactttgacacacaaatggccaaccgactg
ccactgctgtcattgtctaacctaatgagccccagttccactcccactcccagtcccagt
cccaggcccaagctcagtatgttgccaatattggatgggcgtagctcggacatcagtccc
gacacagaacaattacttcgattgcagtcgtccgactacaaactgctgtacaatgccgaa
cggcacacgtatttccaactgcataccataaccggcaatcatcgcgtttcgaatgcgcat
aaggatgcggcggcgtccaatcgaagaaggctcttccagcaggcagtgggcagcaccctg
agtgccgccttcggcctgaatgtgatggcgatggacggacgggccgtgaccacggagacc
gtgcacctctatgatgccgcctcgctgcggcagtcgcgcttcaatcccttcaatccgaca
cgcatcctcatccacggctggctgggcaatgcaaatgccaatatctacagcgccttgctc
ccaccgtacctatcgttggacaagggccggtacaacatcttcaccgtggactggggccgc
ggcgccatagcggactacattacggccagctatcgggtgaagcccgtgggacaggtgctg
gccaaattcgtggactttctgcaccaggaggcgggcctgcggttcgaggatctgcagttg
gtgggcttcagcatgggggcccatgtggcgggcctggctgggaagcacctgcagacgggg
cgcctcaggatgatccgtgctttggatccggccttgccctttttccggtatgcccaggac
aaggagcgtctggccaaaggggatgctgactatgtggaggtgctacatacgagtgtcggc
agctacggcttcgatcgcccgctggggcatgccgatttctacgccaattggggcagtcag
cagccgggctgcttctggcgcgagtgcagccactggagggcattcagcctctttgccgag
agtctgcggcccggccgggaatttccggcccgtggctgtgcggtcagcgaatggcagcag
ttgacccgcttccatcggtgccccagggagacgggcaacagacagagcatgggcggcgat
ttggccaatgcctcaatggagctgcttctggccagacgacagggtgtctattatttcgag
acaaatgctaagccaccctatggcatggttcagcgaaatgtcagcccaaagggaaagcac
aaataa

DBGET integrated database retrieval system