KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18274Help
Entry
Dpse_GA18274      CDS       T01032                                 

Definition
GA18274 gene product from transcript GA18274-RA
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dpse_GA18274
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     Dpse_GA18274
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dpse_GA18274
  Exosomal proteins of breast milk
   Dpse_GA18274
Heparan sulfate/heparin binding proteins [BR:dpo00536]
 Enzymes (General comment) Variety
  Dpse_GA18274
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 461 aa AA seqDB search
MDLEQELVLVPAPGQLPRPAVQVKVTNEVESAMRMMMMMITATGMRQQTNYFDTQMANRL
PLLSLSNLMSPSSTPTPSPSPRPKLSMLPILDGRSSDISPDTEQLLRLQSSDYKLLYNAE
RHTYFQLHTITGNHRVSNAHKDAAASNRRRLFQQAVGSTLSAAFGLNVMAMDGRAVTTET
VHLYDAASLRQSRFNPFNPTRILIHGWLGNANANIYSALLPPYLSLDKGRYNIFTVDWGR
GAIADYITASYRVKPVGQVLAKFVDFLHQEAGLRFEDLQLVGFSMGAHVAGLAGKHLQTG
RLRMIRALDPALPFFRYAQDKERLAKGDADYVEVLHTSVGSYGFDRPLGHADFYANWGSQ
QPGCFWRECSHWRAFSLFAESLRPGREFPARGCAVSEWQQLTRFHRCPRETGNRQSMGGD
LANASMELLLARRQGVYYFETNAKPPYGMVQRNVSPKGKHK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatctggagcaagagctggtgctggtgccggcaccgggacagctgccaagacccgca
gtgcaagtaaaagtgacaaatgaagtggaaagtgccatgagaatgatgatgatgatgatt
actgcgacgggtatgaggcagcagacgaactactttgacacacaaatggccaaccgactg
ccactgctgtcattgtctaacctaatgagccccagttccactcccactcccagtcccagt
cccaggcccaagctcagtatgttgccaatattggatgggcgtagctcggacatcagtccc
gacacagaacaattacttcgattgcagtcgtccgactacaaactgctgtacaatgccgaa
cggcacacgtatttccaactgcataccataaccggcaatcatcgcgtttcgaatgcgcat
aaggatgcggcggcgtccaatcgaagaaggctcttccagcaggcagtgggcagcaccctg
agtgccgccttcggcctgaatgtgatggcgatggacggacgggccgtgaccacggagacc
gtgcacctctatgatgccgcctcgctgcggcagtcgcgcttcaatcccttcaatccgaca
cgcatcctcatccacggctggctgggcaatgcaaatgccaatatctacagcgccttgctc
ccaccgtacctatcgttggacaagggccggtacaacatcttcaccgtggactggggccgc
ggcgccatagcggactacattacggccagctatcgggtgaagcccgtgggacaggtgctg
gccaaattcgtggactttctgcaccaggaggcgggcctgcggttcgaggatctgcagttg
gtgggcttcagcatgggggcccatgtggcgggcctggctgggaagcacctgcagacgggg
cgcctcaggatgatccgtgctttggatccggccttgccctttttccggtatgcccaggac
aaggagcgtctggccaaaggggatgctgactatgtggaggtgctacatacgagtgtcggc
agctacggcttcgatcgcccgctggggcatgccgatttctacgccaattggggcagtcag
cagccgggctgcttctggcgcgagtgcagccactggagggcattcagcctctttgccgag
agtctgcggcccggccgggaatttccggcccgtggctgtgcggtcagcgaatggcagcag
ttgacccgcttccatcggtgccccagggagacgggcaacagacagagcatgggcggcgat
ttggccaatgcctcaatggagctgcttctggccagacgacagggtgtctattatttcgag
acaaatgctaagccaccctatggcatggttcagcgaaatgtcagcccaaagggaaagcac
aaataa

DBGET integrated database retrieval system