KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18468Help
Entry
Dpse_GA18468      CDS       T01032                                 

Definition
GA18468 gene product from transcript GA18468-RA (EC:2.7.11.-)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 1002 aa AA seqDB search
MACFPRLFHHRNKNKFTPAQDENTDTILNTHDSPVQIGLYIRREEKPLYTPIVTPSASEA
KLQRLRLQPANSSSSSSSPSSFPLQTLAENGSENNANSLQRQPKKFRSNKSKLQPCKRKE
KQDDEPQAEGDPVNGNAINVTRSNSKLKPVKERRPTALPTEAPNIEFDDVEESGAGASAD
GGACADGGDAVDGKSKLGVNENGIIDEVVSPSGTTSPATDGGNVKFFIGHTQELSTDQAD
DTLSWQSSDTNNNSNINRTLANGALPQDRPEGGGQQLLEAPPNGKSSSNVSLNYLTKCSG
DSHRRRRASTMPDINIPPAPPMPAELLVPGTPVHLRKKRSVECRQNPQTDDKLSPPEASN
NQEQIPTPSRNSDGEKSRLTESSVPKAHRVEGGLIYVRPNYPIQGDLQIESITKDKATRN
LIHMAIERNDFLNNLMDKERKEMVINAMAPASYKKNSYIIHEHEEGSEIYVSAEGHYDVI
RAGQLVGNFGPATVFGELAILYNAPRQATIKAATDARVWKIARETFRAIMQISGSREREE
NLQFLRSVPFLQELEESLLNKVVDLLQRKFYETGSCIVREGEVGNEFYIIRGGTVTIKKE
DESKEEQVVARRKRGDYFGEQALLNADVRQASVYADAPGTEVLKLDREAFISYLGTIKQL
RDKPSQRTEPHGRSSNKSMEFDNEHAQIAISELKKVATLGAGAFGRVDLVAYGQLTFALK
IIKKIEVVKQDQIEHVYNEKNVMIKCRHSPFIVQLYRTYRNDKYVYFLMEACMGGDVWTV
MSKRQYFDEKTAKFIAGCVVEAFDFLHSHNFIYRDLKPENLMLGTDGYCKLVDFGFAKYV
RPNEKTNTFAGTPEYVAPEIILDRGHDRSVDYWALGILIYELLVGKTPFRGVNQIKIYQQ
ILSGIDVIHMPTRIPKSAQHLVRHLCKQLPAERLGYQRKGISDIKRHSWFESLDWQRLKD
KQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWDVDF
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttcctcgattgttccatcatcgcaacaaaaacaagttcactcccgcccaa
gacgagaacaccgacacgatactcaacacgcacgatagtccggtgcaaattggcttgtac
attcggcgcgaggaaaagcccctttacacgcccatcgttacgcccagtgccagtgaggcc
aagctgcaacggctaagactacagcccgcgaactcctcctcctcatcctcctcgcccagc
agcttcccgctgcagactttggccgaaaacggcagcgaaaacaatgcaaacagcctgcag
aggcagccaaagaagtttcgctccaacaagagcaaactgcagccgtgcaaaaggaaggag
aagcaagatgacgagccgcaggcggagggagaccccgtcaatggcaatgcaattaatgtc
acacgttcaaattccaaattaaagccagtcaaagagcggcgacccacagccctgcccaca
gaggcgcccaatatcgagtttgatgacgtggaggagtcgggggctggggccagcgcagac
ggcggtgcctgtgccgatggaggcgatgctgtcgacggcaagtcaaagctcggagtgaat
gagaatggaataattgatgaggtcgtctcgccgtcgggcaccacatctcctgcaacggat
gggggaaatgtaaagtttttcattggtcatacacaggaacttagcacagaccaagcagat
gataccttgtcctggcagagcagcgacaccaacaacaacagcaacataaaccgcacgttg
gcaaatggggcactgccacaagatcggccagaagggggagggcagcagctgctcgaagct
ccgcccaacggcaagagtagcagcaatgtgtcactcaattatcttacaaagtgcagtgga
gacagtcaccgtcgacgacgtgcgtctaccatgccagatattaacataccgcctgcgccg
ccgatgcctgccgagctgctggtccctggaacgcctgtacacttgcggaagaaacggagc
gtcgaatgccggcagaacccacaaacagacgacaaactaagtcctccggaggcttcgaat
aatcaagaacaaataccaacaccttcgcggaacagcgatggagagaagagccgactcacc
gaatcatcggttccaaaggctcatcgtgtggaaggtggactgatctatgtccgaccgaat
taccccattcaaggcgaccttcaaatcgaatcaattacaaaagacaaagccacacgcaat
ctcatacacatggccattgaacgcaatgatttccttaataacctaatggacaaagagcgg
aaggagatggttatcaatgcaatggcgccggctagctacaaaaagaatagttacatcatc
cacgagcacgaggagggctccgagatatatgtatccgccgagggccactacgatgtgata
cgcgccggacagcttgtgggcaactttggaccggcaaccgtattcggagagctggcaata
ctctataacgcccccaggcaggccaccattaaggctgccactgatgcccgagtttggaaa
atagcacgtgagaccttccgagccatcatgcaaatctcgggttccagggaacgcgaagaa
aaccttcagttcctccggtcggttccatttctgcaagagctcgaggaaagcttgctcaac
aaagttgttgacctcctgcaaaggaaattctatgagactggcagctgcattgtacgtgaa
ggcgaggtgggaaacgagttctatatcattcgaggcggaaccgttaccataaaaaaggag
gacgagtcaaaagaggagcaagttgtggcaaggcgcaagcgaggcgactactttggcgag
caggcgcttctgaatgcggatgtgcggcaggccagtgtctatgcagatgcaccaggcact
gaggtcctaaagttggatagagaagcgttcataagctatttgggaactatcaagcaactt
cgtgacaagcctagtcagcggaccgagccccatggtcgctccagtaacaaaagcatggag
tttgacaacgagcacgcccagatagccatctccgaactgaagaaggtggccaccttgggt
gcaggtgcttttggacgtgtggatctggtggcctatggccagctaacgtttgccctgaaa
ataatcaagaagatcgaggtggtcaagcaggatcagatcgagcacgtctacaacgagaag
aacgtgatgatcaagtgccggcattcgccgttcatagtgcaactctaccgaacgtaccgg
aacgacaaatacgtctactttctaatggaggcctgtatgggcggcgatgtgtggacagtt
atgtcgaagcggcagtacttcgatgagaagaccgccaagtttatagcgggctgtgtcgtc
gaagccttcgactttctgcactcgcacaactttatttacagggacctcaagcctgagaac
ctcatgctgggcacagacggctactgcaaactggtggactttgggtttgccaaatatgtt
cgtccgaatgagaagacaaacacctttgccggtacgccggaatatgtggcacccgagatt
attctggaccgtgggcacgatcggtccgtcgactactgggcgctgggcattctaatctac
gaactgctggttggcaaaacgccctttagaggcgtgaaccaaataaagatttatcagcaa
atcctcagcggcatcgatgtcatacacatgcccactcgaatccccaaatccgcgcagcac
ctggtgcgtcatctgtgcaaacagctgcctgccgaacgcttgggataccagcgcaagggg
atttccgatatcaagcgacacagttggttcgagagtctggattggcagcgactgaaagat
aaacaattgccttccccaataaagcgacccctcaaaagttggaccgacttgcaatacttt
gggccgtccggcgtggaaaacgattatgagccgccggaagagttgagcgggtgggacgtg
gacttttag

DBGET integrated database retrieval system