KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18472Help
Entry
Dpse_GA18472      CDS       T01032                                 

Gene name
Dpse_Tm2
Definition
Tropomyosin 2
Orthology
K10373  
tropomyosin 1
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Dpse_GA18472 (Dpse_Tm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEVDLVTA
KEQLEKANAELEEKEKLLTSTESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSA
DENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAE
DRVRSGEAKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLAIKLKEAEQRAE
HAEKQVKRLQKEVDRLEDRLFNEKEKYKAICDDLDQTFAELTGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcaagcgatgaagcttgagaaggataatgccattgac
aaggcagatacctgcgagaatcaagccaaggatgccaactcccgcgccgacaaactcaat
gaggaagtgcgcgatctggagaagaagttcgtccaggttgaggtcgatttggtcaccgcc
aaggagcagctggagaaggccaacgccgagctggaggagaaggagaaactgttgacctcc
accgagtctgaggtcgccacccagaaccgcaaggtccaacagattgaggaggatctggaa
aagtctgaggaacgctcgaccaccgctcaacagaagctgctggaggccacacagtcggcc
gatgagaacaaccgtatgtgcaaggtgttggagaaccgctcccagcaggatgaggagcgc
atggaccagctgaccaaccagctgaaggaggcccgcatgctcgctgaggatgccgacacc
aagtccgatgaggtttcccgcaagctggccttcgttgaagacgagctggaggtcgctgag
gatcgtgtccgctccggcgaggccaagatcatggagctcgaggaagagttgaaggttgtc
ggaaactccctgaaatctctggaagtgtccgaggagaaggccaaccagcgcgtggaggaa
ttcaagcgcgagatgaagaccctggccatcaagttgaaggaggccgagcagcgcgccgag
cacgccgagaagcaagtgaagcgcctgcagaaggaggtcgacaggctagaagaccgtctc
ttcaatgagaaggaaaagtacaaagcaatctgcgacgatttggaccaaacatttgccgaa
cttactggatattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system