KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18478Help
Entry
Dpse_GA18478      CDS       T01032                                 

Definition
GA18478 gene product from transcript GA18478-RA (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dpse_GA18478
  Lipid metabolism
   00062 Fatty acid elongation
    Dpse_GA18478
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dpse_GA18478
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dpse_GA18478
Lipid biosynthesis proteins [BR:dpo01004]
 Fatty acid synthase
  Component type
   Dpse_GA18478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 282 aa AA seqDB search
MRLRLLLAVFVCFADAYRPVVILHGILSGADSMDFLVREIEELHRGTIVYNCDKFSGWYS
LENAWRQVEQIRDYLSDVGKKHPEGINVLGYSQGGLLARAAIQSLPDHNVKTFISLSSPQ
AGQYGTSFLHLIFPDLAAKTAFELFYTTVGQHTSVGGYWNDPHKQSLYLKYSEFLPLINN
EKQSSNSTSFKMGMVRLSKLVMVGGPNDDVITPWQSSHFAYYDEDLDVIPFNKRKLFTDD
LIGTRTLQEAGKLIIIVKPHVHHLAWHTNRAVIHQVILPYLD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaggctaaggctcttgctggctgtgttcgtctgctttgctgatgcatacaggccggtt
gtgatactccatggaatcctgtcgggcgcggattcaatggactttttggtgcgggaaatc
gaagagctccatcggggcacaatcgtctacaactgcgacaaattcagcgggtggtacagc
ctggagaatgcctggcggcaggtcgagcagattcgggattatttgagcgatgttggtaaa
aagcacccggaaggaatcaatgtgttgggctactcccagggcggactcttggcccgtgcg
gccatccaaagtctgcccgatcacaatgtaaagaccttcatttccctatcttcgcctcaa
gcgggtcaatacggaactagcttcctgcatttgatatttccggatctggcggcgaagacc
gcttttgagctattctacacaacggtagggcagcacacatcggtgggcgggtactggaac
gacccgcataaacagtcactgtatttgaaatacagcgagttcctgccgctgatcaacaat
gagaagcagtcctccaactccacctccttcaaaatgggcatggtgcgtctcagcaagctg
gtcatggtcggcggccccaacgacgatgtgataacgccctggcaatccagccactttgcc
tactacgacgaggacttggacgtgattccgttcaacaagcggaagctcttcactgacgac
ttgatcggcactaggacgctccaagaggccgggaaacttatcatcatagtcaaaccccat
gtccatcatttggcatggcacacaaacagagccgtaatacatcaagttatcttgccatac
ctggactga

DBGET integrated database retrieval system