KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18478Help
Entry
Dpse_GA18478      CDS       T01032                                 

Definition
GA18478 gene product from transcript GA18478-RA (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:dpo01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:dpo00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:dpo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 282 aa AA seqDB search
MRLRLLLAVFVCFADAYRPVVILHGILSGADSMDFLVREIEELHRGTIVYNCDKFSGWYS
LENAWRQVEQIRDYLSDVGKKHPEGINVLGYSQGGLLARAAIQSLPDHNVKTFISLSSPQ
AGQYGTSFLHLIFPDLAAKTAFELFYTTVGQHTSVGGYWNDPHKQSLYLKYSEFLPLINN
EKQSSNSTSFKMGMVRLSKLVMVGGPNDDVITPWQSSHFAYYDEDLDVIPFNKRKLFTDD
LIGTRTLQEAGKLIIIVKPHVHHLAWHTNRAVIHQVILPYLD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaggctaaggctcttgctggctgtgttcgtctgctttgctgatgcatacaggccggtt
gtgatactccatggaatcctgtcgggcgcggattcaatggactttttggtgcgggaaatc
gaagagctccatcggggcacaatcgtctacaactgcgacaaattcagcgggtggtacagc
ctggagaatgcctggcggcaggtcgagcagattcgggattatttgagcgatgttggtaaa
aagcacccggaaggaatcaatgtgttgggctactcccagggcggactcttggcccgtgcg
gccatccaaagtctgcccgatcacaatgtaaagaccttcatttccctatcttcgcctcaa
gcgggtcaatacggaactagcttcctgcatttgatatttccggatctggcggcgaagacc
gcttttgagctattctacacaacggtagggcagcacacatcggtgggcgggtactggaac
gacccgcataaacagtcactgtatttgaaatacagcgagttcctgccgctgatcaacaat
gagaagcagtcctccaactccacctccttcaaaatgggcatggtgcgtctcagcaagctg
gtcatggtcggcggccccaacgacgatgtgataacgccctggcaatccagccactttgcc
tactacgacgaggacttggacgtgattccgttcaacaagcggaagctcttcactgacgac
ttgatcggcactaggacgctccaagaggccgggaaacttatcatcatagtcaaaccccat
gtccatcatttggcatggcacacaaacagagccgtaatacatcaagttatcttgccatac
ctggactga

DBGET integrated database retrieval system