KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18492Help
Entry
Dpse_GA18492      CDS       T01032                                 

Gene name
Dpse_ST6Gal
Definition
GA18492 gene product from transcript GA18492-RA (EC:2.4.99.-)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dpse_GA18492 (Dpse_ST6Gal)
   00514 Other types of O-glycan biosynthesis
    Dpse_GA18492 (Dpse_ST6Gal)
Enzymes [BR:dpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     Dpse_GA18492 (Dpse_ST6Gal)
Glycosyltransferases [BR:dpo01003]
 Terminal extension
  Sialyltransferase
   Dpse_GA18492 (Dpse_ST6Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 452 aa AA seqDB search
MWQVKRALSGQCQTLLGVLLLSAALIIHSAQIGGAAKAQPRLEPGVGEVNSAEAVNENGR
GNVARRLPRSVFHVRWNPNEKFVVESRESPAINSSKLAPHPRLKVSKNTKLTLSPKLYLC
HDKYSELCHNKTQQFRQRIVQTFEKSMSESFNDSQPNPYHVDYKPVFGDSFEEQYYPSTC
LVMEAGVRVLRRKDKPFDKVPFGRLFPRQKLFRNIKNIKTCAIVSSAGSLAGSKLGRFID
THDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFDFAHAPIFRNVTIAAWDPGKY
NGTLEDWLTSADYDLFSNYEIYRRRYPKSRAFLIDPHSVWRLWQTLQMFAGNRSIRRNPP
SSGFIGLALLLPHCPQVDFVEYIPSTRLNGRCHYYSKEMNAACTFGSWHPLAAEKLMTLD
MNTADDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaagtgaaacgcgcattgtcgggtcagtgtcagaccctactcggtgtcctcctt
ctgagcgccgcgttaataattcacagcgcacaaatcggaggagccgcgaaagctcagccg
agactcgaacccggcgtgggtgaggtgaatagcgccgaggcggtcaacgaaaacggacgt
ggaaatgtggcgaggcgactgccgcggagtgtgttccatgtgcgatggaatcccaacgaa
aagttcgttgtggagagtcgcgagagtccggccatcaactcctccaagctggcgccccat
ccgcggctgaaggtctccaagaacacgaagctgacgctcagccccaagctgtacctgtgc
cacgacaagtactcggagctgtgccacaacaagacgcagcagttccggcagcgcatcgtc
cagacctttgagaagtccatgagcgagtccttcaacgactcccagcccaatccctaccac
gtcgactacaagcccgtgttcggggacagcttcgaggagcagtactatccctccacctgc
ctggtcatggaggcgggcgtgcgggtactccgccgcaaagacaaacccttcgataaggtt
cccttcggccgcctctttccgcgccagaagctctttcgcaacatcaagaacatcaagacg
tgtgcaattgtctccagcgcgggctccctggccggctccaagctgggtcgcttcatcgac
acgcacgacattgtgatgcgattcaatcatgcgcctacgcaaggacacgaggtggatgtt
ggcagcaaaaccacaattcgtgtggtgaattctcaagtggtcaccaagcccgagtttgac
ttcgcccacgctcccatctttcgcaatgtgacgatcgccgcctgggatccaggcaagtac
aacgggacgttggaggactggctcaccagcgcggactatgacctgttcagcaactacgag
atctataggcgtcgctatcccaagtcgcgggccttccttattgatccccactccgtgtgg
cgactgtggcagacactgcagatgtttgccggaaaccgttctattaggcgtaatccaccc
agctcgggtttcatcggtctggccctgctcttgccccattgtcctcaggtggactttgtg
gagtacattccctccacgcggctcaatggacgctgtcactactacagcaaggagatgaat
gccgcctgtacatttggctcttggcatcccctggccgccgagaagctgatgacattggac
atgaatacggcggatgacatgtctgtcttccagtttggcatattgcgtatacgcaggccg
gacaaactgctctgcggcttcaacttctttggctattga

DBGET integrated database retrieval system