KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18567Help
Entry
Dpse_GA18567      CDS       T01032                                 

Definition
GA18567 gene product from transcript GA18567-RA (EC:2.1.1.43)
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Dpse_GA18567
Enzymes [BR:dpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dpse_GA18567
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2
AA seq 1541 aa AA seqDB search
MKISAGAHSETDGVGAQSNLSFNADGTATGDAAAGNAESVASQITEHPEKVKEKRRKRSK
IVAHDGDSVTELTENDLNGYLSPKNAPFAIKKQQRLSGLNRKRDLINLQSALSPKYIGFA
NANSPTPLSDSDDTVRTTRRRFTQAAALNSSNNNNHCELQPRDNDAATESPKTLEGTPLL
DRSDSKNYISPIDKLLMKNGASSPNSTGFETDPEDVAPLAARLSLRRKLKRAAKTSPQED
RTEEAATTEMMEQIETTTEMEKKTEEEATTEMEKRTEEAATTEMVKKEEPTLGAENQTEE
ANEKIEKQNEESTSEMVEPPEKVPSVKEEPMEITDLQPKEVSDAKIEDAVPLSTDGNSES
ESRASSCDVVSSSRISLSNENAQDLPGEPTDTSSKTIESTDEPNDPDPDPDPDSESGFAL
PAATSTDMKSPGELSPTAFRQPEDNGYVKSPSSVSLDSAKGLSIVTDPGWGTYQVGDLYW
GKVFSYCFWPCMVCPDPYGQIVGNLPAHPQRTSTDNAPLPIQVHVRFFADSGRRNWIKPE
NLLIFAGLKVYEEQREEVRIKYGNRSGKYRTMVPKRTKLDVWRQAIDEAQLVAEVPYSER
LEKFYQIYESVVTINKQKRKRTNSMTTQDTSDVGSSLYDSTDNLHAKAHLQLMNVKRERS
VTPVSPAFSPVKKSQMRTKRRKLSKGAEAETGGGTVPSESVAGAEKNTTPSNSGGIYENP
EFRQLFDAIQEYVMVYRHDEKVEKVLRAVVGNIWSLKQLQLRELERELAYGEMDQEQLGS
AVVERERGTGTTQRLSNRLKTLVERRSRTPVVTPSGTPTPTASSTIGGAEMRLSEISKPK
KPVNRPIEEVVEDIFQLDSKYLFRGLPRGTVCKYCFKPGSNLLQCSRTCHSWMHADCLES
KRNGLAASKKEGMKLKALEDVSTASSTTPPVPAAEHITGDAPDALATIATAAPTAPTFEV
ICHECNVNGEASCCICLQVLPPAHPSPSPGSPLKEGSSEAKEATPVDGTMIMCGQNLCGR
QYHAGCCKYWPQAIASSSLTRCPLHVCHTCVSDNPRKFLPVGSSKLTRCVKCPASYHQDS
RCVPAGSRMLTTTNLICPRHNVAKTDAHLNVLWCFICVKGGELLCCETCPIAVHAGCRKV
PIKKHENYICEECESGRLPLYGEIVWAKFNNFRWWPAIILPPTEIPNNILKKAHGESEFV
VRFFGTHDHGWIPRRRVYLYIEGDTGEKLKPRSQLHRKFYNGIEEATRFMKITKARRHEQ
MVARGIKVNPPPYVKIRINKAVPPVKFITNSEEHSTCDCRPEDEHPCGANSNCLNRMLFN
ECHPEYCRCGDRCENRMFETRKSPRMDVVYMNARGFGLVCREPIAEGDFIIEYVGEVINQ
EEFQRRMLRKQKDRDENFYFLGVEKEFIIDAGPKGNLARFMNHSCEPNCTSQKWTVNCTN
RVGLFAIQDIPAETELTFNYLWDDLLNDKKKACYCGSERCSGEIGGKLKDKPSNVKLKQQ
QRSRGAAIRIHVPPAKKGKKSVPKIKHVSADDELEEAKKNQ
NT seq 4626 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagtgcgggtgcacactcggaaacggatggtgtgggtgcccaatccaattta
tcgttcaatgctgatggtacagctaccggggacgcggctgcaggcaacgccgagtccgta
gcatcccagataacggagcatccagaaaaagtaaaggagaagcgtagaaaacgcagcaaa
attgtggctcatgatggcgactctgtgacagagttgaccgaaaacgacttgaatggctat
ttgagtccgaaaaacgcgccattcgccataaaaaaacagcagcgtctctcagggttgaac
agaaagcgcgatttaattaatttgcagtcggcattgagccccaaatacattggctttgcg
aatgccaactccccgacgccattgtccgactcggacgacactgtgcgcacaacgcgtcgt
cgcttcactcaagctgcagccctcaacagcagcaacaacaacaaccactgcgagctgcag
cccagggacaatgacgcggcaacagaatcaccaaagaccttggaagggacaccgctgcta
gatcgcagtgatagcaaaaactacataagccccatcgataagcttctaatgaaaaatggc
gccagctcgccaaacagcacaggcttcgaaacagatcctgaagacgtggcaccactagcc
gcccgcctgagtctgagacgtaaactgaagcgggctgcaaaaacgagtccgcaggaagat
cggacagaggaagcagcgactacagagatgatggaacagatagagacgactacagagatg
gaaaagaagacagaagaagaagcgactacagagatggaaaagcggacagaggaagcagcg
actacagagatggttaaaaaagaagaaccaactctaggcgcggaaaatcagacagaggaa
gcaaatgaaaaaattgaaaaacaaaatgaagaatctacttctgagatggtagagccccca
gagaaagttccttctgtgaaggaagaaccaatggaaataaccgatttacaaccaaaagaa
gtctccgatgctaaaatcgaagacgccgtccccctcagcacggatggaaactccgagtcg
gagtctcgggcttcttcctgcgatgtggtcagtagcagcaggatttcgttgagcaacgaa
aacgcacaagacttgcctggcgagcctaccgatacgagtagcaaaaccattgagtccact
gacgaaccgaacgaccctgaccctgacccagacccagactctgaatcggggtttgccttg
ccagcggcaacatcaacagacatgaaatcccctggggagctgagcccgacagccttccgg
cagcccgaggacaacggatacgtgaagtcgccatcttcggtgagcctggacagcgccaag
ggtttgtccatagtcacggatccgggctggggcacctatcaggtgggtgatctgtattgg
ggcaaggtattttcgtactgcttctggccgtgtatggtgtgcccggatccgtatggtcag
attgtgggcaaccttccggcccatccgcagcgcacatcgacggacaacgcccccttgccc
atccaggtgcatgtgcgcttctttgccgacagtgggcggcgcaactggattaagcccgag
aatctccttatctttgccggcctcaaggtatacgaggagcagcgcgaggaggtgcgcatc
aagtatggcaacaggagcggcaagtaccgcaccatggtgcccaagcggacgaaactagat
gtctggcggcaggccatcgacgaggcccagctggtggcggaagtgccctactccgagcga
ctcgagaaattctatcagatttatgagagcgttgtaaccattaacaaacagaaacggaag
cgcaccaactccatgacgacgcaggacacgtcggatgtgggtagcagcctgtacgactcc
acagacaacttgcatgccaaggcccatctgcagctgatgaacgtgaagcgcgagcgctca
gtgacgcccgtaagtcccgccttctcgcccgtcaagaagagtcagatgcgtaccaagcga
cgaaagctgagcaaaggagctgaggcggagactggcggcggcaccgtgccatcggaaagt
gtggcaggcgcggagaagaataccactccctccaattcggggggcatctacgagaatcca
gagtttcgtcagctattcgatgcgatccaggaatatgtgatggtctatcgtcacgacgag
aaagtggaaaaggtgcttcgggccgttgtgggcaatatctggtcattgaagcagctccag
ttgcgcgaactagagcgagagttggcctacggcgaaatggatcaggaacagcttggatcg
gcagtcgttgaacgggaacgcggcaccggcaccacccagcggctgtccaatcgcctgaaa
acgctggtggagcgacgaagccgtacaccagtggtcacgcccagtggtacgccgacaccc
accgccagcagcaccatcggtggggcggagatgcgtctttcggaaatttccaagccgaaa
aagccagtgaatcggcccatcgaggaggtggtcgaagatatattccagctggacagcaag
tacctattccgcggcctcccccgcggcaccgtctgtaaatattgcttcaaacccggctcg
aatctgctgcagtgctcgcggacctgccacagctggatgcatgccgattgcctggagagc
aagaggaatggcctggccgcatccaaaaaggaaggaatgaagcttaaagctttggaagat
gtgtctacagcctcctccaccacgccgcccgttcccgcagcggagcacataacaggcgat
gcgccggacgctttagccactatcgctactgctgcaccgactgctcccacctttgaagtg
atctgccatgagtgcaatgtgaacggagaagcaagctgttgcatttgccttcaagtgttg
ccgcccgcacacccctcgccgtcccccggctcgccgctgaaagaaggctcaagcgaggca
aaggaagccacgccagtggacggcacgatgataatgtgtggccaaaacctgtgcggccgc
caataccacgccggatgctgcaaatactggccacaggcgatcgccagcagctcactgacc
cgctgccccctgcacgtttgccacacgtgcgtctcggacaatccccgtaaattcctaccg
gtgggcagcagcaagcttacgcgctgcgtcaaatgcccagcctcgtaccatcaggactcg
cgctgcgtacccgccggcagccggatgctgaccaccacgaacctcatctgcccgcgacac
aatgtggccaagaccgatgcccacttgaatgtcctgtggtgcttcatctgcgtcaagggc
ggggagctgctgtgctgcgagacctgtcccattgccgtgcacgcgggctgtcgcaaggta
ccgatcaaaaagcacgagaactacatctgcgaggagtgcgagagtggacgactgccgctc
tatggggagatcgtttgggccaaattcaacaactttcgctggtggccggccattatcctg
ccgcccacggagataccgaacaacattctcaagaaggcccacggcgagagcgagtttgtg
gtgcgattcttcggcacccacgatcacggatggataccacgacgacgtgtctacctgtat
atcgagggcgacactggggagaagctgaagcccaggtcgcagctgcaccgaaaattctat
aacggcattgaggaggccacgcgatttatgaaaatcaccaaggccaggcgccacgagcag
atggtggctcgcggtattaaggtgaatccgccaccatatgtgaaaatcaggatcaacaag
gcagtgccgccagtgaagttcatcacgaattcggaggaacacagcacatgtgattgccgg
cccgaggatgagcatccgtgcggcgccaactccaactgcctcaatcggatgctgttcaac
gaatgccatccggagtactgtcggtgcggcgaccgatgcgaaaatcgcatgtttgagacc
cgcaaatcgccccgcatggatgtggtctatatgaatgcccgtggattcgggcttgtctgt
cgtgagcccatcgccgagggcgatttcatcatcgagtatgtgggggaggtgatcaatcaa
gaggagttccaacggcgcatgctccggaagcaaaaggatcgcgacgagaacttctacttc
cttggcgttgagaaggagttcatcatcgatgccggcccaaagggaaacctggcccgcttc
atgaatcactcatgcgagcccaattgcacctcacaaaaatggactgtcaactgcaccaat
cgtgtgggactcttcgccattcaggacattccagcggagacggagctgacgttcaattat
ctgtgggatgatctgctgaatgacaaaaagaaagcctgctactgtggctcggaacgctgt
tccggggagataggcggcaagcttaaagataagcccagcaatgtaaagctgaagcaacag
caacgcagcagaggagctgccattcgaatccatgtacctccggccaagaagggaaagaag
tctgttcccaagatcaagcacgtgagcgccgacgatgagctcgaagaggctaaaaagaat
cagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system