KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18598Help
Entry
Dpse_GA18598      CDS       T01032                                 

Definition
GA18598 gene product from transcript GA18598-RA
Orthology
K14548  
U3 small nucleolar RNA-associated protein 4
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
Ribosome biogenesis in eukaryotes
Class
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dpo03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 703 aa AA seqDB search
MTAILNEPPQGGGKQQLHNARFYTIKPRAIVGMAYNKLSKCLALSRETDCIELWNMEYAP
YLDRVIHLPPGSPVEALAWAGTKRLFSADLTGKLIEWDVLRLRQRYEQSPTGNALWSMDI
NGQETELAVGSEEGHINIMSIENDEITYKSIFNKQKGRVLCCKFDKSGKHLITGSEGYVR
IWSVLKGHTLHTMTLSAKDVNVWCLRVLADNTIVAGDSAGFVTVWNAENATQIDRQRVLD
KNVFALALNEEEDRLVCSGMEPPLIRVFSKTKIRREESESERWIKFLQRDAHKHYVKSLA
MIDPLIVSGGLDGILTITSSERSSLPQLSQHAPFLQGSAASVAIDAKLLLLRYPHSLDLW
RLGTVAARQEEEDEDEERWDLPVGHTEDLVLAKPPQKLLQLNVREKSFIQAAALSPDAAW
ICYSTLTDVRLSRLTQAPLQVERRPAEDLPQELTPASHILFTKQQQLLLLDPKANRVNFF
DLEEDRVLFRSSLDLGAHLKRSVSHLVVSPDGEYLVAASTDHLIGVWRLQPAGKHKHLVN
LPRHRAGTTALAMHEGRPRLVVAYADGRLVEYDLVKRAFTCETVEYLIPGTKHFCIRGII
LDPKNPNIFLVHTEEYLYVLERNKRLATEDYVVNTKSKKYSQESRSLIAANPNGMRLKTQ
LRRQHLVHVFRLSPNELVNVSISTSNLLASLPPPFQRKRFGAS
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaatactgaacgaaccaccccagggcggtggcaagcagcagctgcacaacgca
cgcttctacacgataaaaccgcgcgccatcgtgggaatggcgtacaacaagttgtccaaa
tgcctcgctttgagtcgagagacggactgcattgagctgtggaacatggaatatgcccca
tatctggacagggtgatccatttgccgcccggctctcccgtggaggccttggcctgggct
ggcaccaaacgcctcttctccgcggatcttacgggcaaactgatcgagtgggatgtgctg
cggctcaggcagcgctacgagcaatcacccacgggcaatgccctctggagcatggacatc
aatgggcaggagacggagctggccgtcggctccgaagagggacacatcaacatcatgagc
atcgagaacgacgagatcacctacaagagcatcttcaacaagcagaagggccgcgtgctc
tgctgcaagttcgacaaatcgggaaagcacctgatcaccggctccgagggctacgtccgc
atctggagcgtcctcaaaggccacacgctgcacacgatgacgctgtccgccaaggacgtg
aacgtctggtgcctccgggtgctggccgacaacaccatcgtggcgggcgactcggcgggc
tttgtcacggtgtggaatgccgagaatgccacgcagatcgacaggcagcgcgtcctcgac
aagaacgtcttcgcgctggccctcaacgaggaggaggaccgactggtgtgcagcggcatg
gagccgccgctgatccgggtcttcagcaagacgaagatcaggcgcgaggagtccgagagc
gagcgctggatcaagttcctgcagcgagacgcgcacaagcactacgtcaagtcgctggca
atgattgatcccctgattgtgtccggcggcctggatggcatcctcaccatcacgtccagc
gagcggagctcgttgccacagctctcgcagcacgcccccttcctgcagggctccgcggcc
tcggtggccatcgatgcgaagctcctgctgctccgctacccccacagcctggacctgtgg
cgactgggcaccgtcgcggcccgccaggaggaagaggacgaggatgaggagcgctgggac
ctgcctgtgggccacacggaggatctggtgctggcgaagccgccacagaagctcctgcag
ctgaatgtccgtgagaagagcttcatccaggccgctgcactgtcgccagacgccgcctgg
atctgctactccactctgacggatgtccggctgagccgcttgacgcaggctcccctgcag
gtggagcggcgcccggcagaggatctgccccaagagctgacccccgcgagccacatcctc
ttcacgaagcagcaacaactcttgctcctcgatcccaaggccaatcgcgtgaacttcttc
gacctggaggaggatcgcgtcctgttccgctccagcctagacctcggcgcacacttgaaa
aggagcgtcagccacctggtggtctccccggacggcgagtacctggtggcggcctccacc
gaccaccttatcggcgtctggcggctgcagcccgccggcaaacacaagcatttggtgaac
ctgccccgtcatcgggccggcaccaccgccctggccatgcacgagggtcgcccccgcctg
gtggtggcctacgccgacgggcggctggtggagtacgatctggtgaagcgtgccttcacc
tgcgagacagtggagtacctgattccaggcaccaagcacttctgcatccgcggcatcatc
ctggatccgaagaaccccaacatcttcctcgtccacacggaggagtatctgtacgtgctg
gagcggaacaagcgcctcgccaccgaggattatgtcgtcaacacaaagtccaagaagtac
agccaggagagccgcagcctcatcgcagccaatccgaatggaatgcgcctcaagacacag
ctgcggcgacagcacctggtgcatgtcttccgtctgagtcctaacgaactcgtcaacgtc
agcatttcgacaagcaatctgctggcatcgctcccaccgccgttccagcgaaagaggttt
ggagcctcctag

DBGET integrated database retrieval system