KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18605Help
Entry
Dpse_GA18605      CDS       T01032                                 

Definition
GA18605 gene product from transcript GA18605-RA
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dpse_GA18605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
XR
AA seq 437 aa AA seqDB search
MVLVGNAIWKWSRLFGALLLLLGVFRTASGLSSRVLELSDRFIDVRHEGQWLVMFYAPWC
GYCKKTEPIFGLVAQALHATNVRVGKLDCTRYPASAREFKVRGYPTIMFIKGNMEFTYNG
DRSRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFMFVGQQEGVVWDTYYAAAEGY
QEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHVAHEMDPNEVNETIFQWVN
VERFTLFPKVTRFNIHQLLKTQKYLVLAVVQEDKLSQIATHELEFRDMVEGVIRKHRPRY
HNKFQFGWIGEPAIAHSIILDQLPTPHLIAINSSTQHHFIPDDDPMQMTPQALHLFLESI
SNESAIAYGGDTYFVRCNRALFELKRSLKDMWKGNPVLTTVIFGLPLGFLLLIMYSIFCG
DCLVTEEDQDEDHEKKE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcgtcggcaacgcaatctggaagtggagccgtctcttcggtgccctgctactg
ctgctgggagtgttcaggaccgcctcaggcctatcctcgcgggtcctggagctgagcgat
cggttcatcgatgtccgtcacgagggccagtggctggtgatgttctacgccccgtggtgc
ggctactgcaagaagacggagccaatattcggtctggtggcgcaggcgctgcatgccacc
aatgtgcgggtggggaaactcgattgcaccaggtatccggcatctgcccgcgagttcaag
gtgcgcggctatcccacgataatgttcatcaagggcaacatggagttcacctacaacggc
gaccggagtcgcgacgaactcgtggactatgccctgcgcatgtccgggccgcccgtgcag
ctcgtgacgcgcacagagagcgtggatatgctcaagggatcgcacacgatcttcttcatg
ttcgtcggccagcaggagggcgtcgtctgggacacgtactatgcggcagcggagggctac
caggagcacggcttcttctatgccaccagcgaggacattgccgcccagcactttgacttc
gagaagctgccggcggttatcgtctacaaggaggagcagcaccacttctatccgcacggc
catgtggcccacgagatggaccccaacgaggtgaacgaaacgatcttccagtgggtcaat
gtggagcggttcaccctcttccccaaggtcacgcgcttcaacatccaccagctgctgaag
acccagaaatacctggtcctggccgtcgtccaggaggataaactcagccagatcgccacg
cacgagctggagttccgcgacatggtcgaaggcgttatccggaagcacaggccgcggtat
cacaacaaatttcagtttggatggattggcgagcccgccatcgcccattccatcatcctg
gaccagctgccgaccccgcatctgatagcgatcaattcgagcacccagcaccacttcata
cccgacgacgatcccatgcagatgacgccgcaggctctccacctcttcctcgagtccatc
agcaacgagagcgccatcgcgtatggcggcgacacctactttgtgcgctgcaatcgggcg
ctgttcgagctgaagcgttcgctgaaggacatgtggaaggggaatcccgtgctgacgacc
gtcatctttggcctgccgctgggcttcctcttgctgatcatgtactccatattctgcggt
gattgcctcgtcaccgaggaggaccaggacgaggatcacgagaaaaaggagtaa

DBGET integrated database retrieval system