KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18638Help
Entry
Dpse_GA18638      CDS       T01032                                 

Definition
GA18638 gene product from transcript GA18638-RA (EC:2.7.11.-)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     Dpse_GA18638
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   Dpse_GA18638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3
AA seq 312 aa AA seqDB search
MSQSPQHKRQKMSNGRNFEDYEELNIIGTGAYGTVYRARDTVTGNIVALKKIRIALNENG
VPMSTLREISLLKQLNASDHANIVKLFEVCQFLERDGQLMILLVFEHLEQDLSDLIERLP
KSGMSPITIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLVSAQGHLKIADFGLAKTYNSE
MKLTSVVVTLWYRAPEVLLIQPYNSSVDLWSAACIIFEMFNRKALFPGTSEKNQLDRIFE
LTGRPTDQQWPKTISVAREHFPHRLPKRPRDFCPNLCEFSDDLLNQMLSYDINMRPSALV
CLQHDYFTQEPL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcgcctcaacacaagcgtcagaagatgtccaatggaagaaactttgaggac
tacgaagaactcaacatcattggaacaggcgcctatgggactgtctacagggcccgggac
acagttacgggcaatattgtggccctgaaaaagatccgcatcgccctcaatgagaacgga
gtaccgatgtccacgttgcgggagatctccctgctgaagcagctcaatgcgagcgatcac
gccaacattgtcaaactgttcgaagtatgccagtttctggagcgcgacggacaactaatg
attctcctggtctttgagcacctggagcaggatttgtctgacctcatcgaacgcctgccc
aaatcgggcatgtcccccatcacaatccagcgtctgtcgcgggagctcctgaccggcgtg
gactttctgcactcgcatcgcatcatccaccgcgatctgaaaccgcagaatctgctagtt
tccgctcagggccatctgaagatcgccgattttggtctggccaaaacgtacaactccgaa
atgaagctgacatcagtggttgttacgctgtggtatcgcgctcccgaggtacttcttatc
cagccctacaacagttccgtggatctctggagtgccgcctgcataatctttgagatgttc
aaccggaaggctctgttcccgggcacatcagagaagaaccagctggatcgtatattcgag
ctgacgggccgacccacagatcagcaatggcccaaaaccatctctgtggcacgggagcat
ttccctcaccgccttcccaagcggccacgtgacttttgtcccaacctgtgcgagttctcc
gatgacctgttgaatcaaatgctgtcgtacgacataaacatgcgcccctcggccctggtt
tgcctacagcacgattacttcacgcaggagcctctttaa

DBGET integrated database retrieval system