KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18654Help
Entry
Dpse_GA18654      CDS       T01032                                 

Definition
GA18654 gene product from transcript GA18654-RA (EC:2.7.1.-)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dpse_GA18654
Protein kinases [BR:dpo01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   Dpse_GA18654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 2481 aa AA seqDB search
MSTSSVVQNFVNGLKSRNRNVQNKAAQDLFLYVKTELREMSQEELAQFFDEFDHHIFNMV
NAADINEKKGGALAMKCLITSDGLTTRKGISPYLNRLRDLLLINDVSVMEIAARSLVKLA
NMPGSKGADSFDFDIKKAFEMLSGDRQEYRRHAAVFILRELAIALPTYFYQQILTFFEHI
FNAIFDPKPAIRESAGEALRAALIVTAQRENTKQSSEPQWYKICYDEASASFNQDVATGK
EQKGMTRDDRIHGGLIVFNELFRCANASWERRYTALKTLFPKAHHNKFLEASSHSSMSSQ
LNTFVPRLKVPFIDKLGSTQMHMEAEHHHNGMAKFASHNVLESAYAHEILQAHYTTICDN
VLEQRFSKSPYVQQALLQILPRLAAFNREVFVEKYLQICVPHLMQILRGKEKDRTVAYIT
IGYLAVAVESAIEKYLETIMSCVKMALPAKDLASSKRKAPVDPAVFACITLLAHAVRSEI
VKDVRDILEQMFSTGLSPALTVCLRELSENVPQLKSGITDGLIGVLSQVLMNKPAAIPYA
ALPPIAIDGSLIMQMADGGTTVLALKTLGTFNFEEQNMLDFVQRCADYFIVHEQQEIRLE
AVQTCTRLLKLAVQSAESMENSKTLSDTVSHVIERLLMVAITDMDCNVRIRILRSLDETF
DAKLAQPESLNSLFITLHDEIFEIRELAMVTIGRLSSMNPAYVMPKLRTTMIELLTDLKY
SGMNRNKEQSARMLDHLVISTPRLISSYMNPILKALVPKLHEPESNPGVILNVLRTIGDL
AEVNGGSNEMELWADDLLSILLEMLGDAGSPDKRGVALWTLGQLISATGRVVSPYHKYPV
LIDILINFLKTEQRRSIRRETIRVLGLLGAMDPYKHKMNKGLIDSQKDNVLIAYSDGKVD
ESQDISTAELLVNMGNALDEYYPAVAIAALMRILRDPTLSTRHTSVVQAVTFIFQSLGIK
CVPYLAQVLPNLLDNVRTADNNLREFLFQQLAILVAFVKLHIISYMSDIFKLIKEFWTIN
TPLQSTLINLIEQIAVALGCEFRDYLAELIPQILRVLQHDNSKDRMVTRRLLQALQKFGS
TLGYYLPLIVPPIVKLFDSPYVPQQVSLVALETINNLACQLDFTDFSSRIIHPLVRVLDT
EPELRDQAMTTLRSLVKQLGKKYLVFVPMVQRILTKHRIGDSEYDKLLIRLQNNSTLADA
CGTGEFGLRQAKIKYNEPFVTDRNSNNRNLQVSTNVLRTAWQVTRRVSKDDWVEWLKRLS
IGLLKESPSHALRACCSLAQEYDTLLRDLFNAAFISCWTELSPEHKHELTQSLIQALQVT
DMPEITQTILNLAEFMEHCDRDPIPIETNLLGTRAMACRAYAKALRYKEEEFLLKEEASV
FESLILINNKLQQREAAEGLLTTYRNAANELNVQGRWYEKLHNWDQALEHYERNLQTDSS
DLEARLGHMRCLEALGDWSELSQVTKREWEGFGTEARARASPLAAVAAWGLQDWEAMREY
VRCIPEDTQDGSYYRAVLAVHHDDFETAQRLIDETRDLLDTELTSMAGESYERAYGAMVC
VQMLAELEEVIQYKLIPERREPLKTMWWKRLQGGQRLVEDWRRIIQVHSLVVKPHDDIHT
WLKYASLCRKSGSLHLSHKTLVMLLGTDPKLNPDEKLPCNQPQVTFAYTKYMAASNQLQE
AYDQLRCFVDKYSTELSCLPPEAVKPQDQRLMARCYLRLATWQNKLQERLCPGAIQGDLE
CFEKATSYDPNWYKAWHRWAYMNFKVVQAQKTALDKQQASLPPGLNIGIGLSMDSDMLII
QQYAVPAVQGFFRSISLIKGNSLQDTLRLLTLWFDYGNHAEVYDALMSGMKLIEINTWLQ
VIPQLIARIDTHRQLVGQLIHQLLMDIGKNHPQALVYPLTVASKSASLARRNAAFKILDS
MRKHSPTLVEQAVMCSEELIRVAILWHEQWHEGLEEASRLYFGDRNVKGMFEILEPLHAM
LERGPQTLKETSFSQAYGRELTEAYEWSQRYKTSAVVMDLDRAWDIYYHVFQKISRQLPQ
LTSLELPYVSPKLMTCKDLELAVPGSYNPGQELIRISHIKTNLQVITSKQRPRKLCIRGS
NGKDYMYLLKGHEDLRQDERVMQLFSLVNTLLLDDPDTFRRNLAIQRYAVIPLSTNSGLI
GWVPHCDTLHTLIRDYRDKKKVPLNQEHRTMLNFAPDYDHLTLMQKVEVFEYALGQTQGD
DLAKLLWLKSPSSELWFERRNNYTRSLAVMSMVGYILGLGDRHPSNLMLDRMSGKILHID
FGDCFEVAMTREKFPEKIPFRLTRMLIKAMEVTGIEGTYRRTCESVMLVLRRNKDSLMAV
LEAFVYDPLLNWRLLDVDKKGNDAAGANGGGAAGRGGSGMQVGNSGDSLSNSVEDSLPMA
KSKTYEAQLLLQQAGGLHNNVADETNSKASQVIKRVKCKLTGTDFQTQKSVNEQQQVELL
IQQATNNENLCQCYIGWCPFW
NT seq 7446 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcttcggtggtgcagaatttcgtgaacggtctaaagtcccgcaatcgcaat
gtccagaacaaagccgcccaagacctcttcctgtatgtcaaaacggagctgcgagaaatg
tcccaggaggagctggcgcagttctttgatgagtttgatcatcatatattcaacatggtg
aatgcggcggacatcaatgagaagaaaggcggggcgttagccatgaagtgccttatcacc
agcgacggtctgaccaccagaaaaggcatctccccgtatcttaatcgcctacgcgatctg
ttgcttatcaacgacgtgtccgtcatggaaattgctgcccgttccctggtcaaattggcc
aatatgcctggctccaagggcgccgactccttcgattttgacatcaaaaaggcctttgag
atgctcagcggcgacagacaagagtatcgtcgccatgctgcggtctttatcctacgggag
ttggctatagcattgcccacgtatttctaccagcaaatcctcaccttcttcgagcacatt
ttcaatgcaattttcgatcccaagcctgccatacgcgagtccgctggcgaggccttgagg
gccgccctcattgtgaccgcacagcgggagaacaccaagcaatcgagtgagccgcaatgg
tataagatctgctacgatgaggccagtgccagtttcaaccaggatgtggccacgggcaag
gagcagaagggcatgactcgcgacgatcgcatacatggcggccttatagtgttcaatgag
ctctttcgctgcgccaatgccagctgggagcgacgctatacggcgctgaaaacgctcttt
cccaaggcgcatcacaacaaatttctggaggccagcagccactcgagcatgagttcacag
ctgaacacgtttgtgccgcgcctgaaggtgccattcattgacaaattgggcagcacacag
atgcacatggaggccgagcatcatcacaatggaatggcaaagtttgccagccataacgtt
ttggaatcggcctatgctcatgagatactgcaggcgcactataccaccatctgcgacaat
gtgctggagcaacgcttctccaaatccccctatgtgcagcaggcactgcttcaaatactg
ccccgtttggcggcctttaatcgagaggttttcgttgagaaatacctgcagatctgcgta
ccacatttgatgcaaatactgcgtggcaaagagaaggatcgcactgtggcctatatcacc
attggctacctggccgtggccgtggagagtgccattgaaaagtatctggagaccatcatg
tcctgcgtaaagatggctctacccgccaaggatttggccagcagcaagcgcaaggccccc
gtcgatccggcagtgtttgcctgcatcacgttgctggcgcatgccgttcgttcggaaatt
gtcaaggatgtgcgggacatactagagcaaatgttctccacgggcctgtcgcctgcgctg
accgtctgcctacgtgagctgtctgagaatgtgccgcagctcaagtcgggcatcaccgat
ggtctgattggggtgctctcgcaggttctaatgaacaagccggcggccattccatacgcc
gccctgccacccattgccattgatggctctctgataatgcagatggctgatggcggcacc
acagtgctggccctcaagacattgggaacgtttaactttgaagagcagaatatgttggac
tttgtgcagcgctgcgctgactacttcatcgttcacgaacagcaggagatacgcctggag
gcagtgcagacgtgcacgcgtctgctaaagctggccgttcagtccgcggagagcatggag
aactccaaaaccctgagcgacaccgtttcccatgtgattgagcgcctgctgatggtggcc
atcacggacatggactgtaatgtgaggatacggattctacgctctctggacgagaccttc
gatgccaagctagcgcagcccgagtccctcaattcgctgtttatcacgctgcacgatgag
atctttgagatccgagaactggcaatggtaaccattggacgactgtcctctatgaatccc
gcctatgtgatgcccaagctgaggaccaccatgatcgagctgctgacggatctaaaatat
tcggggatgaaccgcaacaaggagcagagcgcgaggatgttggaccatctggtgattagt
acgccccgtttgatatcctcgtacatgaatccgatactgaaggctctggtgccgaagcta
cacgagccggaatcgaatcctggcgtcatcctaaatgtacttcgcaccattggggatctg
gcggaggttaacggtggctccaatgaaatggaactgtgggccgatgacctgctctccatt
ctgctggaaatgctgggggatgccggctctcccgataagcgaggcgtggccctgtggacg
ctgggacagctgatcagtgccacgggacgagtggtcagtccctaccacaagtatccggtg
ctcatcgacatcctcataaacttcctgaagacggagcagcggcgctccatacgccgcgag
acgatccgcgtgctgggcctcctgggggccatggatccgtacaagcacaagatgaataag
ggtctaattgacagccaaaaggacaacgtactgatcgcctactccgatgggaaggtggac
gagagccaggacatatccacagccgagttactcgtgaatatgggcaatgctctggacgaa
tactatcccgcggtggccatagccgccctgatgcggatactgcgtgatcccaccctgagt
acccgccacacgagcgtcgtgcaggccgtgacgtttatcttccagagcctcgggatcaaa
tgtgtcccgtatttggctcaagtgctgcccaatctgctggacaatgtacgaacggcggac
aacaatctgcgagagtttctgttccagcagctggccattttggtggccttcgtgaagctg
cacatcatcagctacatgagcgacatcttcaagctgatcaaagagttctggaccatcaat
acgcccctgcagtccacgctgatcaatcttatagaacagattgccgtggccttgggctgc
gagtttcgggactatctggcagagctcataccacagatactgcgagtgctgcagcatgac
aactccaaggatcgaatggtcaccaggagattgctgcaggctttgcagaagtttggcagc
actttgggctactatctaccgctgattgtcccgcccatagtgaagctcttcgattcgccg
tatgtgccacagcaagtgtcgctggtggcccttgagacgatcaataatctggcctgccag
ctcgactttacggacttctcctccaggatcatacaccctttggtgcgagtgttggacaca
gagccagagctgcgcgaccaggccatgaccacactccgttctctggtcaagcagcttggc
aaaaagtatctcgtgttcgtgcccatggtgcagcgcatcctcacgaagcatcgcattggg
gatagcgagtacgacaagctgttgattcgcctgcagaacaacagcactctagcggatgcc
tgcggcacaggggagttcggtttgcggcaggccaagatcaagtacaacgagccctttgtc
acggacaggaacagcaataatcggaatctgcaggtctcgacgaatgtcctacgcactgcc
tggcaggtcacacgtcgtgtttcgaaggatgattgggtcgagtggctgaaacggctgtcc
attggcctgctcaaggaatccccctctcatgcgctgcgtgcctgctgctctctggcccag
gagtacgatacgctgctgagggacttgttcaatgccgccttcatctcctgctggacggaa
ctgtcgccggagcacaagcacgagctgacgcagtcgttgatccaggccctgcaggtcacc
gatatgccagagatcacccaaacaatccttaatctggccgagtttatggagcactgcgac
cgggatcccatacccattgagacgaatcttttgggcacccgagccatggcctgtcgcgcc
tatgccaaagccctgcgctacaaggaggaggagttcctgctaaaagaagaggcgtcggtc
tttgagtcgctgatcctcatcaacaacaagctgcagcaaagagaggcggccgagggtctt
ctgaccacataccggaatgcggccaacgagctgaatgtccagggacgctggtacgagaag
ctccacaactgggatcaggccttggagcactacgaacgcaatttacagacggattcatcg
gacctggaagcgcgtctggggcacatgcgctgcctggaggccctcggcgactggtcggag
ctgagtcaggtgaccaaacgcgagtgggagggcttcggcacagaggccagagcacgggcc
agccctctggctgcagtggctgcatggggtctgcaggactgggaggccatgcgggagtat
gtgcgctgtatacccgaggatacgcaggatgggagctactatcgggctgtcctggccgta
caccacgatgactttgagacggcccaaaggttgattgacgagaccagggatctgctggac
acagaactgacctccatggcgggagaatcctacgagcgagcttacggtgccatggtctgc
gtgcaaatgctggcggaactcgaagaagtcatccagtacaagctgatccccgagcgaagg
gaacccctgaagaccatgtggtggaagcgactgcagggaggacagcggctggtggaggat
tggcgccgcatcattcaggtgcattcgctggtggtgaagccccacgacgacatccacacg
tggctgaagtacgccagtctctgccggaagagcggttccctgcatctctcccacaagacg
ctggtgatgctgctaggcacggatcccaagctaaatccggacgaaaagctgccctgcaac
cagccgcaggtcacctttgcatataccaaatacatggccgcatcgaatcaactgcaggag
gcatacgaccagcttcggtgttttgtcgataagtacagcacggagctgagctgcctgccg
ccggaggctgtgaagccccaggatcagcgattgatggccaggtgctacttgcggctggcc
acctggcagaacaaactccaggagcgtctatgtccgggggccattcagggtgatctggag
tgctttgaaaaggccaccagctacgacccgaactggtacaaggcctggcaccggtgggcc
tacatgaacttcaaggtggtgcaggcccagaagacggcgctggacaagcagcaagcatcg
ctgccgccgggactgaacatcggcattggcctgagcatggacagcgacatgttgatcatc
cagcagtatgcagtgcccgcggtgcagggcttcttccgttcgatcagcctgatcaagggg
aactccctacaggacacgctgcgactgctgacactctggtttgactatggcaaccatgcg
gaggtgtacgacgccctgatgtcgggcatgaagctgatcgagatcaacacctggctgcag
gtgataccccaactgattgcacgcatcgatacgcatcggcagttggtaggccaattgatc
caccagctgctcatggacattggcaagaatcatccgcaggccctggtctatccgctgacg
gtagcctccaaatccgcttcgctggcacgcaggaatgccgccttcaagatcttggactca
atgcggaaacactcacccacgctcgtggagcaggcggtgatgtgcagcgaggagctcatc
cgtgtggccatcctctggcacgagcagtggcacgagggtctggaagaggcctcccgcctg
tacttcggggatcgcaatgtaaaagggatgtttgagatcctagagccgctgcacgccatg
ctggagcgtggcccgcagacactcaaggagacctccttctcgcaggcctacggccgggaa
ctgacggaagcgtatgagtggtcgcagcgctacaagacctcggcggtggtgatggacttg
gaccgtgcctgggatatttattatcatgtgttccagaagatctcacgccaactgccgcag
ttgacgtcgctggagcttccgtatgtctcgcccaagctgatgacctgcaaggacctagag
ctggccgtccctggatcctacaaccctggccaggagttgatacgtatcagccacatcaag
acgaacctgcaggtgatcacgtccaagcagcgaccgcgcaagctctgcattcgcggatcc
aacggcaaggactacatgtacctgctgaagggccacgaggatctgcggcaggatgagcgt
gtaatgcagctattctcgctggtcaacaccctcttgctggacgacccggacacgttccgt
aggaatttggccattcagcgatacgctgtgatcccgctgagcaccaattcgggtctgatc
ggctgggtgccgcactgtgatacgctccacacgctgatacgcgactatcgggacaagaag
aaggtgccgctcaaccaggagcaccgcaccatgctgaactttgccccggactacgaccac
ttgacgctcatgcagaaggtggaggtgtttgagtacgctttagggcagacgcagggcgac
gatctggcaaagctgctatggctcaagtccccctcctcggagctgtggttcgagcggcgc
aacaactatacccgatccctggccgtcatgtcgatggtgggttatatccttggcctgggc
gatcgccatccctccaacctcatgctggatcgcatgagcggcaagattctgcacattgac
tttggtgattgcttcgaggtggccatgacgcgggagaagttccccgagaagatacccttc
cgactcacgcggatgttgatcaaggccatggaggtgacgggcatcgagggaacgtaccga
cgcacctgcgagagcgtgatgctggtgctgcgacgcaacaaggactcgctgatggccgtg
ctggaggcgtttgtgtacgatccgctgctcaattggcgactcctcgatgtcgacaagaag
ggtaacgatgcggcgggtgccaatggcggcggtgccgccggtcgtggcggctctggcatg
caggtgggcaatagcggcgatagtttaagcaactctgtggaggattccctgcccatggcc
aagtcgaagacttacgaggcgcagctgctgctgcagcaagccggtggcttgcacaacaac
gtggccgacgagacgaacagcaaggctagtcaggtaatcaagcgggtcaagtgcaagcta
acgggcacagatttccaaacgcagaagagcgtcaacgagcagcagcaggtggagctgctc
atccagcaggcaaccaacaacgagaacctctgccagtgctacattggctggtgtccgttc
tggtaa

DBGET integrated database retrieval system