KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA18752Help
Entry
Dpse_GA18752      CDS       T01032                                 

Definition
GA18752 gene product from transcript GA18752-RA (EC:2.3.1.-)
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dpse_GA18752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4
AA seq 836 aa AA seqDB search
MAMESGTSSSESGSTTTSGSTSCTDTGSSSDSDSSSATPEEKPSTAAAPASKSQQQQQQQ
TSGSTALRRKATATEAEKPKSFGTTSLTSAASKVRSVAASNHRLTSDDDDEDDTPPPVKK
NARSNNTGTAAIAATAATAAPATRRKPPPAIGRAKPPPASRSNNPPQRSAPVARATENGD
CKRPSLSSSSNSTDDSTKVTKNGRKVPLKMASTVRAKQVAARGKLPQIKKNGSGAGPAPV
PVPPPPISSEGSDSESGTGSGDDSSSGSDSEGSDSSNSYSSQPPKNAKGKRPVVGGKPPR
SDSEEERKDKANPMRKLTRSLSMRRSKQQQPKEETDFESDEDLENDKMLLTKSSPGKKPA
PSILNSAKSKVKKEGVAISSGVFSSLKSRPVSPITQTEKKCPIEGCDSSGHLSGNLDKHF
LPEACPIYHNMSASECKERASERKIRNEQRGKMPISIVKAPGNQHTNLKSLTPEQREFLA
KIRESRASFRPINNNFMDSKVKLEKDCTDEDREPSLTGLVPDYDLQLFREAQAQASERIE
DELKDLPVGKGIKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHA
EKCVWRHPPGDEIYRKGKLQVWQVDGKRHKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYI
MTLADIDGCHIVGYFSKHIPFLQEKNSFYNVSCILTLPPYQRKGYGRLLIDFSYLLTRVE
GKIGSPEKPLSDLGLISYRSYWKDVLLDYLCNRSGNTLNIKDVSQEMAIYSYDIVSTLQA
LGMMKYWKGKHIVLKKQDVLDEYEERVKRRGTFPKIDDSCLRWQPFIPVQPSAESP
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggccatggagtcggggacaagcagctcagagtcgggcagcacaacaacaagtggttcc
accagctgcacagacacgggcagctcctcggactcggattccagcagtgcaacgcccgag
gagaaaccctcgacggcagctgctccggcctcgaaatcccagcagcagcagcaacaacaa
acatccggctccacagcgctacgccgaaaagcgacagcgacagaagcagaaaagcccaag
agtttcggtacgacttctctgacgtcggctgccagtaaagtgcgctccgtggcggcctcc
aatcatcgtttgaccagcgatgacgacgacgaggatgacacgccgccgcctgtgaagaaa
aatgcacgctccaacaacacaggaacagccgcaatcgcagcaacagcggcaacagcagca
ccagcaacaaggcggaagccacctcctgctataggaagagcaaagcctccgccggcatcg
agaagcaataatccaccacagagatctgcgccagtcgctcgggccacggagaatggcgac
tgcaagaggccatcgctctcctcctcctccaacagcacggatgactcgacaaaagtgacc
aagaacggccgcaaggtgcccctcaagatggccagcacagtacgggctaagcaggttgca
gctagaggtaaactgccgcaaatcaagaagaatggtagtggtgcagggccagccccagtg
ccagtaccaccaccgccaatcagcagcgagggaagcgattcagagagcggtaccggctct
ggggatgactccagctcgggtagcgactcggagggcagtgattccagcaactcgtacagt
tctcagccgcccaagaatgccaagggcaagcggccagtagtaggaggcaagccgccacga
tcggacagcgaggaggagcgcaaggacaaggccaatccaatgcgaaagctaacccgatcg
ctgagcatgcgcaggtcaaaacagcaacagcccaaagaggagaccgacttcgaatcggat
gaggatctggagaacgacaagatgttgctcacaaaaagcagccccggcaagaagccggct
ccctcaatcctcaacagtgccaagagcaaggtgaaaaaggagggagttgccattagtagt
ggagtgttcagctccctcaagtctcgtccagtgtcgcccattacccaaacggagaagaag
tgccccatcgagggctgcgactcctctggccacctcagcggcaatctggacaagcatttt
ctgcccgaagcgtgtcccatttaccacaacatgtccgcctccgagtgcaaggagcgggcc
agcgagaggaagatccgcaacgagcaacgtgggaagatgcccatcagcattgtgaaggcg
cctggcaatcagcatacaaatctcaaatcgcttacgcccgaacagcgtgagtttctggcc
aagatcagagaatctcgagcgagttttcggcccatcaataataatttcatggattcaaaa
gttaagctcgaaaaagactgcaccgatgaggatcgtgaaccgagtctcacgggcctggtg
cccgactatgacctgcaattgtttcgcgaggcccaggctcaggcctccgaaaggatagaa
gacgaactcaaggatctgcccgtaggaaaaggaatcaaatacataagcatgggcaaatac
aaaatgaaagtctggtatcagtccccgtatccggatgatgctgcccgcctgcccaagatg
tacatttgcgagttctgcctgcgataccagaaatccgagacgggcatcaagcggcatgcg
gagaaatgcgtctggcggcatccgccaggcgatgaaatttatcgcaaggggaagctgcag
gtctggcaggttgatggcaagcgccataagcaatactgtcagcatctctgtctgctggcc
aagttcttcctggaccacaagaccctctactatgatgtggaaccatttctgttctacatc
atgacgctggcagatatcgatggctgtcatattgtgggctactttagcaagcatattcct
ttcctgcaagagaaaaactcgttttataatgtctcatgtatcttaacactgccgccatat
caaagaaaaggctatgggagattactcatcgatttcagctatctcctgacacgagtggag
ggcaaaatcggttcgccggagaaaccgctatccgatctgggcctgatctcgtacagatcc
tactggaaggatgtgctgttggactatttgtgcaatcgttcagggaataccctgaacatc
aaggatgtatctcaggaaatggccatatactcttatgatatagtcagcaccttgcaggcg
ctgggcatgatgaagtactggaagggcaagcatatagtactcaaaaagcaagacgttctg
gatgagtacgaggagcgtgttaaacgtcgtggtacctttcccaaaatagacgactcctgt
ctgcgctggcagcccttcattcctgtacagcccagtgccgaatcgccttaa

DBGET integrated database retrieval system